Basic Information | |
---|---|
Taxon OID | 3300003140 Open in IMG/M |
Scaffold ID | Ga0051081_1007819 Open in IMG/M |
Source Dataset Name | Human fecal microbial communities from Washington University at St. Louis, Missouri, USA, of twins - TS29 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Washington University in St. Louis |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3579 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Huma Fecal → Human Fecal Microbial Communities From Washington University At St. Louis, Missouri, Usa, Of Twins |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Washington University at St. Louis, Missouri, USA | |||||||
Coordinates | Lat. (o) | 38.63549 | Long. (o) | -90.264891 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F078822 | Metagenome | 116 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0051081_10078191 | F078822 | N/A | ILFVKHFFDIFLSFPNAFLKAFHLHAVRFPAAFLLVHRFYLAFEELLSCATAYL* |
⦗Top⦘ |