Scaffold Ga0052259_1012231

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0052259_1012231

Scaffold Ga0052259_1012231

Overview

Basic Information
Taxon OID	3300003138 Open in IMG/M
Scaffold ID	Ga0052259_1012231 Open in IMG/M
Source Dataset Name	Sediment microbial communities from subsurface aquifer at Rifle, CO - flow-through sediment column
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of California, Berkeley
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3825
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Sediment → Sediment Microbial Communities From Subsurface Aquifer At Rifle, Co

Source Dataset Sampling Location
Location Name	USA: Rifle, CO
Coordinates	Lat. (^o)	39.529053	Long. (^o)	-107.772406	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017253	Metagenome	242	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0052259_10122313	F017253	AGGTGG	MLKSVFLLTANVGSYMQVRIAGDFLSSRKAAWAERCTPKTTAAALDG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.