| Basic Information | |
|---|---|
| Taxon OID | 3300003138 Open in IMG/M |
| Scaffold ID | Ga0052259_1012231 Open in IMG/M |
| Source Dataset Name | Sediment microbial communities from subsurface aquifer at Rifle, CO - flow-through sediment column |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of California, Berkeley |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3825 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lotic → Unclassified → Sediment → Sediment Microbial Communities From Subsurface Aquifer At Rifle, Co |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Rifle, CO | |||||||
| Coordinates | Lat. (o) | 39.529053 | Long. (o) | -107.772406 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F017253 | Metagenome | 242 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0052259_10122313 | F017253 | AGGTGG | MLKSVFLLTANVGSYMQVRIAGDFLSSRKAAWAERCTPKTTAAALDG* |
| ⦗Top⦘ |