| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300003138 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0111418 | Gp0097814 | Ga0052259 |
| Sample Name | Sediment microbial communities from subsurface aquifer at Rifle, CO - flow-through sediment column |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of California, Berkeley |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 32714692 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Sediment Microbial Communities From Subsurface Aquifer At Rifle, Co |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Sediment → Sediment Microbial Communities From Subsurface Aquifer At Rifle, Co |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | freshwater biome → aquifer → sediment |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Sediment (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Rifle, CO | |||||||
| Coordinates | Lat. (o) | 39.529053 | Long. (o) | -107.772406 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F017253 | Metagenome | 242 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0052259_1012231 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3825 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0052259_1012231 | Ga0052259_10122313 | F017253 | MLKSVFLLTANVGSYMQVRIAGDFLSSRKAAWAERCTPKTTAAALDG* |
| ⦗Top⦘ |