NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0051099_113111

Scaffold Ga0051099_113111


Overview

Basic Information
Taxon OID3300003136 Open in IMG/M
Scaffold IDGa0051099_113111 Open in IMG/M
Source Dataset NameMarine microbial communities from the Lost City Hydrothermal Field
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)754
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Marine → Marine Microbial Communities From The Lost City Hydrothermal Field

Source Dataset Sampling Location
Location NameLost City Hydrothermal Field, Atlantic Ocean
CoordinatesLat. (o)30.12Long. (o)-42.12Alt. (m)Depth (m)731
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F079616Metagenome115Y

Sequences

Protein IDFamilyRBSSequence
Ga0051099_1131111F079616N/AARRYWYKLGGLKKDEMYTVVGFNPYDKGLILKEVKSPGSGYNAFAAERFRKVDYEFAKKTIQELDTQHSY*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.