3300003136: Marine microbial communities from the Lost City Hydrothermal Field

Overview

Basic Information

• IMG/M Taxon OID: 3300003136
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0062049 | Gp0052121 | Ga0051099
• Sample Name: Marine microbial communities from the Lost City Hydrothermal Field
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 24827591
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Marine Microbial Communities From The Lost City Hydrothermal Field
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Marine → Marine Microbial Communities From The Lost City Hydrothermal Field

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine hydrothermal vent biome → marine hydrothermal vent → hydrothermal fluid
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Subsurface (non-saline)

Location Information

• Location: Lost City Hydrothermal Field, Atlantic Ocean
• Coordinates
  • Lat. (^o): 30.12
  • Long. (^o): -42.12
  • Alt. (m): N/A
  • Depth (m): 731

Associated Families

Family	Category	Number of Sequences	3D Structure?
F079616	Metagenome	115	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0051099_113111	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia	754

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0051099_113111	Ga0051099_1131111	F079616	ARRYWYKLGGLKKDEMYTVVGFNPYDKGLILKEVKSPGSGYNAFAAERFRKVDYEFAKKTIQELDTQHSY*