Scaffold Ga0052258_104464

Overview

Basic Information

• Taxon OID: 3300003126
• Scaffold ID: Ga0052258_104464
• Source Dataset Name: Human gut microbial communities from lean and obese individuals in Granada, Spain - Lean sample
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Institute of Catalysis, The Higher Council for Scientific Research (CSIC)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 533
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Gut → Human Gut Microbial Communities From Lean And Obese Individuals In Granada, Spain

Source Dataset Sampling Location

• Location Name: Granada, Spain
• Coordinates
  • Lat. (^o): 37.17
  • Long. (^o): -3.59

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056682	Metagenome	137	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0052258_1044642	F056682	N/A	MKMQSRAGKAANQPIERGKMYSASFRGFPSKNRITFPIQELGKIYENQEVL*