3300003126: Human gut microbial communities from lean and obese individuals in Granada, Spain - Lean sample

Overview

Basic Information

• IMG/M Taxon OID: 3300003126
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0111467 | Gp0097811 | Ga0052258
• Sample Name: Human gut microbial communities from lean and obese individuals in Granada, Spain - Lean sample
• Sequencing Status: Permanent Draft
• Sequencing Center: Institute of Catalysis, The Higher Council for Scientific Research (CSIC)
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 11889690
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Gut Microbial Communities From Lean And Obese Individuals In Granada, Spain
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Gut → Human Gut Microbial Communities From Lean And Obese Individuals In Granada, Spain

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal distal gut

Location Information

• Location: Granada, Spain
• Coordinates
  • Lat. (^o): 37.17
  • Long. (^o): -3.59
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042936	Metagenome	157	N
F056682	Metagenome	137	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0052258_102586	Not Available	522
Ga0052258_104464	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	533

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0052258_102586	Ga0052258_1025861	F042936	MGRGGGKGRVWKTKERIMKTSGIVDRGEDTIRNFEKVEQEGALTPPYLGKVYFRSRLRGKG*
Ga0052258_104464	Ga0052258_1044642	F056682	MKMQSRAGKAANQPIERGKMYSASFRGFPSKNRITFPIQELGKIYENQEVL*