Scaffold Ga0051101_113333

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0051101_113333

Scaffold Ga0051101_113333

Overview

Basic Information
Taxon OID	3300003105 Open in IMG/M
Scaffold ID	Ga0051101_113333 Open in IMG/M
Source Dataset Name	Fresh water viral communities from Lake Needwood, MD
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	J. Craig Venter Institute (JCVI)
Sequencing Status	Finished

Scaffold Components
Scaffold Length (bps)	669
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Fresh Water → Fresh Water Viral Communities From Lake Needwood, Md

Source Dataset Sampling Location
Location Name	Lake Needwood, Maryland, USA
Coordinates	Lat. (^o)	39.121	Long. (^o)	-77.129	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002343	Metagenome / Metatranscriptome	568	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0051101_1133333	F002343	N/A	VGDAVNEIDLKVTLEEAVGIVNLLGSLPTAQGAHPLWLKLKAQVEPLIPKPDEVQQ*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.