3300003105: Fresh water viral communities from Lake Needwood, MD

Overview

Basic Information

• IMG/M Taxon OID: 3300003105
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0063260 | Gp0052157 | Ga0051101
• Sample Name: Fresh water viral communities from Lake Needwood, MD
• Sequencing Status: Finished
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 3617333
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Fresh Water Viral Communities From Lake Needwood, Md
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Fresh Water → Fresh Water Viral Communities From Lake Needwood, Md

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): freshwater lake biome → freshwater lake → lake water
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline)

Location Information

• Location: Lake Needwood, Maryland, USA
• Coordinates
  • Lat. (^o): 39.121
  • Long. (^o): -77.129
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002343	Metagenome / Metatranscriptome	568	Y
F032996	Metagenome	178	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0051101_100241	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2549
Ga0051101_113333	Not Available	669

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0051101_100241	Ga0051101_1002415	F032996	MINEKTKGGSGKTYSVFEITSKTTGRKHFMVSSRYTLENILSGIRTYVDSKTVGGGAKELAQDIYNAGKNYEEDFTVKEVGKGMSREIAERRRAELVTKSGEVYNQEIGVT*
Ga0051101_113333	Ga0051101_1133333	F002343	VGDAVNEIDLKVTLEEAVGIVNLLGSLPTAQGAHPLWLKLKAQVEPLIPKPDEVQQ*