Scaffold Ga0051101_100241

Overview

Basic Information

• Taxon OID: 3300003105
• Scaffold ID: Ga0051101_100241
• Source Dataset Name: Fresh water viral communities from Lake Needwood, MD
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 2549
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (28.57%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Fresh Water → Fresh Water Viral Communities From Lake Needwood, Md

Source Dataset Sampling Location

• Location Name: Lake Needwood, Maryland, USA
• Coordinates
  • Lat. (^o): 39.121
  • Long. (^o): -77.129

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032996	Metagenome	178	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0051101_1002415	F032996	N/A	MINEKTKGGSGKTYSVFEITSKTTGRKHFMVSSRYTLENILSGIRTYVDSKTVGGGAKELAQDIYNAGKNYEEDFTVKEVGKGMSREIAERRRAELVTKSGEVYNQEIGVT*