| Basic Information | |
|---|---|
| Taxon OID | 3300003099 Open in IMG/M |
| Scaffold ID | Ga0052239_109266 Open in IMG/M |
| Source Dataset Name | Fresh water viral communities from Lake Needwood, Maryland, USA - June 2007 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | J. Craig Venter Institute (JCVI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1411 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Unclassified → Fresh Water → Fresh Water Viral Communities From Lake Needwood, Md |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Needwood, Maryland, USA | |||||||
| Coordinates | Lat. (o) | 39.121 | Long. (o) | -77.129 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F082341 | Metagenome | 113 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0052239_1092662 | F082341 | AGGAG | MASVMAGDREAAGAIAGMQDVYGRPLPDRGQAIRGVTGGKRWSGMCAHSDQIRVIVEIEPDVFLTVSPADIEID* |
| ⦗Top⦘ |