Scaffold Ga0052239_109135

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0052239_109135

Scaffold Ga0052239_109135

Overview

Basic Information
Taxon OID	3300003099 Open in IMG/M
Scaffold ID	Ga0052239_109135 Open in IMG/M
Source Dataset Name	Fresh water viral communities from Lake Needwood, Maryland, USA - June 2007
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	J. Craig Venter Institute (JCVI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	745
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Fresh Water → Fresh Water Viral Communities From Lake Needwood, Md

Source Dataset Sampling Location
Location Name	Lake Needwood, Maryland, USA
Coordinates	Lat. (^o)	39.121	Long. (^o)	-77.129	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033015	Metagenome	178	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0052239_1091351	F033015	GGA	MSPEDTHTIRADIRELRDELSKVVDLQRETNRRLGKLEGRVFDLEIWRARLQGAAATSRVVWLLAGGA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.