| Basic Information | |
|---|---|
| Taxon OID | 3300003099 Open in IMG/M |
| Scaffold ID | Ga0052239_100828 Open in IMG/M |
| Source Dataset Name | Fresh water viral communities from Lake Needwood, Maryland, USA - June 2007 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | J. Craig Venter Institute (JCVI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 669 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Unclassified → Fresh Water → Fresh Water Viral Communities From Lake Needwood, Md |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Needwood, Maryland, USA | |||||||
| Coordinates | Lat. (o) | 39.121 | Long. (o) | -77.129 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005585 | Metagenome / Metatranscriptome | 395 | Y |
| F056187 | Metagenome / Metatranscriptome | 138 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0052239_1008281 | F005585 | N/A | MAIRDTVYYAFTKSRDNSVFSSETQLTLHSFLSRQNSAEWWKVQSARIRISISLDTPLSWLSPDFRHQKLGMTLSLTRNSNNHQWCDYCKSRWGQLKDGTWHLKAQVPAVWKVVSETPNRRGQVRFYCQSCANEAQNWPDGTFWSLKEQLTYAIDQFAGREKLDVELP* |
| Ga0052239_1008282 | F056187 | GGAG | MSNYLDDYVSVQDRLKEFIGDHPDYRIKTHVLEESLTPNCDVYIVKTELYRTE |
| ⦗Top⦘ |