NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0052264_102069

Scaffold Ga0052264_102069


Overview

Basic Information
Taxon OID3300003098 Open in IMG/M
Scaffold IDGa0052264_102069 Open in IMG/M
Source Dataset NameMarine microbial communities from surface seawater at Gulf of Maine
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)30546
Total Scaffold Genes44 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)15 (34.09%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Communities From Surface Seawater At Gulf Of Maine

Source Dataset Sampling Location
Location NameGulf of Maine
CoordinatesLat. (o)43.14Long. (o)-68.33Alt. (m)Depth (m)1.5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F055778Metagenome / Metatranscriptome138Y

Sequences

Protein IDFamilyRBSSequence
Ga0052264_10206924F055778N/AMFSNVDFPEPDAPTIKTTSPCSIEKDTSSRAFTLLSPSP*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.