Scaffold Ga0051076_100772

Overview

Basic Information

• Taxon OID: 3300003091
• Scaffold ID: Ga0051076_100772
• Source Dataset Name: Hot spring microbial communities from Five Geothermal Springs in Yellowstone National Park, USA - Norris Geyser Basin, Beowulf Spring
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1319
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Candidatus Marsarchaeota → Candidatus Marsarchaeota group 2 → Candidatus Marsarchaeota G2 archaeon BE_D (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Five Geothermal Springs In Yellowstone National Park, Usa

Source Dataset Sampling Location

• Location Name: Norris Geyser Basin, Beowulf Spring, Yellowstone National Park, USA
• Coordinates
  • Lat. (^o): 44.7315
  • Long. (^o): -110.711361

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026924	Metagenome / Metatranscriptome	196	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0051076_1007722	F026924	AGGTGG	MSVGKVCRREHYRFEASKIVHLGWHSFHMPVIVYGHDPDPGKAQGDLCINVDGFYEPIGSFRENNLILSPMMGVKVEDVGESK*