| Basic Information | |
|---|---|
| Taxon OID | 3300003088 Open in IMG/M |
| Scaffold ID | Ga0052170_100180 Open in IMG/M |
| Source Dataset Name | Acid mine drainage microbial communities from Carnoules, Gard, France, unbinned |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | CEA Genoscope |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 126178 |
| Total Scaffold Genes | 136 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 89 (65.44%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Acid Mine Drainage → Acid Mine Drainage Microbial Communities From Carnoules, Gard, France |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Carnoules, Gard, France | |||||||
| Coordinates | Lat. (o) | 43.303 | Long. (o) | 6.188 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F053270 | Metagenome / Metatranscriptome | 141 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0052170_10018093 | F053270 | N/A | VQALLPTVGNRALVAGRKIFLRFAQASDVERLTREGVITAPPPAKETWNQRIVRWLSEQRAGRRAVLVAEDATGLLGILHLVFELPVGFKDPEAANGFDIAMIEGLHVRAGAPPEVGNEMVEEIQRIAVKRNVTTLTFCIPMNQPRAIRLVKEWGFEEFRIMAEPSKMLAFFRKTV* |
| ⦗Top⦘ |