x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300003088
3300003088: Acid mine drainage microbial communities from Carnoules, Gard, France, unbinned
Overview
| Basic Information |
| IMG/M Taxon OID | 3300003088 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063632 | Gp0097390 | Ga0052170 |
| Sample Name | Acid mine drainage microbial communities from Carnoules, Gard, France, unbinned |
| Sequencing Status | Permanent Draft |
| Sequencing Center | CEA Genoscope |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 3308498 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | Acid Mine Drainage Microbial Communities From Carnoules, Gard, France |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Acid Mine Drainage → Acid Mine Drainage Microbial Communities From Carnoules, Gard, France |
| Location Information |
| Location | Carnoules, Gard, France |
| Coordinates | Lat. (o) | 43.303 | Long. (o) | 6.188 | Alt. (m) | N/A | Depth (m) | N/A |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
| F053270 | Metagenome / Metatranscriptome | 141 | Y |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
| Ga0052170_100180 | Ga0052170_10018093 | F053270 | VQALLPTVGNRALVAGRKIFLRFAQASDVERLTREGVITAPPPAKETWNQRIVRWLSEQRAGRRAVLVAEDATGLLGILHLVFELPVGFKDPEAANGFDIAMIEGLHVRAGAPPEVGNEMVEEIQRIAVKRNVTTLTFCIPMNQPRAIRLVKEWGFEEFRIMAEPSKMLAFFRKTV* |