Scaffold Ga0051126_10660

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0051126_10660

Scaffold Ga0051126_10660

Overview

Basic Information
Taxon OID	3300003075 Open in IMG/M
Scaffold ID	Ga0051126_10660 Open in IMG/M
Source Dataset Name	Coral viral communities from Mount Irvine Bay, Buccoo, Tobago - healthy corals
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	506
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → environmental samples → uncultured gamma proteobacterium HF0070_03O15	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Cnidaria → Unclassified → Unclassified → Unclassified → Coral → Coral Viral Communities From Mount Irvine Bay, Buccoo, Tobago, From Healthy And Bleached Corals

Source Dataset Sampling Location
Location Name	Mount Irvine Bay, Buccoo, Tobago
Coordinates	Lat. (^o)	11.183496	Long. (^o)	-60.816715	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F100979	Metagenome	102	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0051126_106602	F100979	N/A	MVKLAILKALSFSSVLVLLLIVALSPLYVTMGLMTRQMQEKTN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.