| Basic Information | |
|---|---|
| Taxon OID | 3300003075 Open in IMG/M |
| Scaffold ID | Ga0051126_10434 Open in IMG/M |
| Source Dataset Name | Coral viral communities from Mount Irvine Bay, Buccoo, Tobago - healthy corals |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 567 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Cnidaria → Unclassified → Unclassified → Unclassified → Coral → Coral Viral Communities From Mount Irvine Bay, Buccoo, Tobago, From Healthy And Bleached Corals |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mount Irvine Bay, Buccoo, Tobago | |||||||
| Coordinates | Lat. (o) | 11.183496 | Long. (o) | -60.816715 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F006772 | Metagenome | 365 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0051126_104341 | F006772 | N/A | MPQPKSGRQIIMERLNKAIQLATTADLQRAAMFLEGAREVRKGSRRQRTNARSAQATAWKKKVDDSITW* |
| ⦗Top⦘ |