Basic Information | |
---|---|
Taxon OID | 3300003075 Open in IMG/M |
Scaffold ID | Ga0051126_10434 Open in IMG/M |
Source Dataset Name | Coral viral communities from Mount Irvine Bay, Buccoo, Tobago - healthy corals |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 567 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Cnidaria → Unclassified → Unclassified → Unclassified → Coral → Coral Viral Communities From Mount Irvine Bay, Buccoo, Tobago, From Healthy And Bleached Corals |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Mount Irvine Bay, Buccoo, Tobago | |||||||
Coordinates | Lat. (o) | 11.183496 | Long. (o) | -60.816715 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F006772 | Metagenome | 365 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0051126_104341 | F006772 | N/A | MPQPKSGRQIIMERLNKAIQLATTADLQRAAMFLEGAREVRKGSRRQRTNARSAQATAWKKKVDDSITW* |
⦗Top⦘ |