Scaffold Ga0052263_10085

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0052263_10085

Scaffold Ga0052263_10085

Overview

Basic Information
Taxon OID	3300003073 Open in IMG/M
Scaffold ID	Ga0052263_10085 Open in IMG/M
Source Dataset Name	Marine surface microbial communities Puget Sound, Washington, USA
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Washington
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	592
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Communities From Surface Seawater At Puget Sound

Source Dataset Sampling Location
Location Name	Beach at Golden Gardens Park, Seattle, WA, USA
Coordinates	Lat. (^o)	47.6906558	Long. (^o)	-122.404411	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032291	Metagenome / Metatranscriptome	180	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0052263_100852	F032291	AGG	VTAVGVPLIAPVEASKDKPAGSDGEIDQLVIVPPFTVGVAVVMAVPLVKLNVLGLYVRDEGATSFTTIVTVTVSLPPVL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.