| Basic Information | |
|---|---|
| Taxon OID | 3300002977 Open in IMG/M |
| Scaffold ID | soap12_1024288 Open in IMG/M |
| Source Dataset Name | Biogas reactor microbial communities from Swedish University of Agricultural Sciences, Alnarp, Sweden |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1468 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Biotransformation → Unclassified → Unclassified → Unclassified → Biogas Reactor → Biogas Reactor Microbial Communities From Swedish University Of Agricultural Sciences, Alnarp, Sweden, And As, Norway That Are Enriched On Cellulose |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | SLU, Alnarp, Sweden | |||||||
| Coordinates | Lat. (o) | 55.656904 | Long. (o) | 13.082968 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F008498 | Metagenome / Metatranscriptome | 332 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| soap12_10242883 | F008498 | N/A | MGTVSYKNQPAIDKTKGNVPLAGTSHIYKVKKRLWNDSIEDVLQELFIGRTLHVCCGKSLIGDVRLDIDAEHNPDIVCDASNMKDFVKDNEFETVLCDPPYNGKFQWNHDLLYELQRVASKRIIFQHWFIPANKDGLYKKAQEKFELTELLCWQPKTYFGRVQMVSVFDRR* |
| ⦗Top⦘ |