NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI26059J44795_1067155

Scaffold JGI26059J44795_1067155


Overview

Basic Information
Taxon OID3300002956 Open in IMG/M
Scaffold IDJGI26059J44795_1067155 Open in IMG/M
Source Dataset NameMarine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - 250m_A/KNORR_S2/LV
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)506
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Affecting The Dissolved Organic Carbon Pool

Source Dataset Sampling Location
Location NameSouth Atlantic Ocean
CoordinatesLat. (o)-37.9983Long. (o)-44.9998Alt. (m)Depth (m)220
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F090504Metagenome108N

Sequences

Protein IDFamilyRBSSequence
JGI26059J44795_10671551F090504N/AMEIFVVLTIIFGLILPYWAGVMAKRKGKSFVIWCILQLLFFFPIILIAFHSPIEKKK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.