| Basic Information | |
|---|---|
| Taxon OID | 3300002925 Open in IMG/M |
| Scaffold ID | Pfgo_1036812 Open in IMG/M |
| Source Dataset Name | Hot springs facies microbial communities from Mammoth Hot Springs, Yellowstone National Park, Wyoming, USA - MHS-Pond Facies_GO |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Illinois, Urbana-Champaign |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3065 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Unclassified → Unclassified → Hot Springs Facies → Hot Springs Facies Microbial Communities From Mammoth Hot Springs, Yellowstone National Park, Wyoming, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Yellowstone National Park, USA | |||||||
| Coordinates | Lat. (o) | 44.9766 | Long. (o) | -110.7016 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F044988 | Metagenome | 153 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Pfgo_10368124 | F044988 | N/A | MSTLSIEMLTPERVIELWPVLEPYFDAACKGNEIASDEMNAKDIYVLAVTGMVAVIVGFEDNEPACVLCIQFHNTNGRKGADVVALAGRSLLKFKAAYWRTILDWLKANGVEFLDTYVPMQRARLYMKRFGFNKSCAYIRMTLQGEKDEQSC* |
| ⦗Top⦘ |