Scaffold JGI25387J43893_1045572

Overview

Basic Information

• Taxon OID: 3300002915
• Scaffold ID: JGI25387J43893_1045572
• Source Dataset Name: Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 609
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location

• Location Name: Angelo Coastal Reserve, California, USA
• Coordinates
  • Lat. (^o): 39.73825
  • Long. (^o): -123.6301

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090925	Metagenome	108	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI25387J43893_10455721	F090925	AGG	MRYWLFLVVAIVALVGCGAGHANLTSITVSPQSATSTSNPQGQVGYTATGNFANGKSRELSQVDGLSWKTSP