| Basic Information | |
|---|---|
| Taxon OID | 3300002900 Open in IMG/M |
| Scaffold ID | VAL_1029809 Open in IMG/M |
| Source Dataset Name | Vent enrichment cultures of iron-reducing bacteria from Chocolate Pots hot spring, Yellowstone National Park |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Wisconsin, Madison |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 683 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Iron-Reducing Enrichment Culture → Iron-Reducing Enrichment Culture Microbial Communities From Chocolate Pots Hot Spring, Yellowstone National Park, Wyoming, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Yellowstone National Park, Wyoming | |||||||
| Coordinates | Lat. (o) | 44.71538 | Long. (o) | -110.73627 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F046219 | Metagenome | 151 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| VAL_10298091 | F046219 | N/A | RALDLRAALKLGVRLDLDEIRADEFAAILLIAEEVDVLEKERLSGQMGPR* |
| ⦗Top⦘ |