3300002900: Vent enrichment cultures of iron-reducing bacteria from Chocolate Pots hot spring, Yellowstone National Park

Overview

Basic Information

• IMG/M Taxon OID: 3300002900
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0111366 | Gp0096875 | Ga0051991
• Sample Name: Vent enrichment cultures of iron-reducing bacteria from Chocolate Pots hot spring, Yellowstone National Park
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Wisconsin, Madison
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 42105186
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Iron-Reducing Enrichment Culture Microbial Communities From Chocolate Pots Hot Spring, Yellowstone National Park, Wyoming, Usa
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Iron-Reducing Enrichment Culture → Iron-Reducing Enrichment Culture Microbial Communities From Chocolate Pots Hot Spring, Yellowstone National Park, Wyoming, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): aquatic biome → hydrothermal vent → spring water
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Subsurface (non-saline)

Location Information

• Location: USA: Yellowstone National Park, Wyoming
• Coordinates
  • Lat. (^o): 44.71538
  • Long. (^o): -110.73627
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F046219	Metagenome	151	Y
F093160	Metagenome / Metatranscriptome	106	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
VAL_1003699	Not Available	694
VAL_1029809	Not Available	683

Sequences

Scaffold ID	Protein ID	Family	Sequence
VAL_1003699	VAL_10036991	F093160	NNYCGSREQLKVWLWPKVSACHGIDDEAEEADKMAVDPQGNVYIIDDRYRVAKINGLTDAVTEVIEIPGFDCEASVPDGSPVVFRNTANNIAYMPHGQGKLYVVSEQNTITLIQWKVTNKKTTRTLTTLTLPAAAELDAITTDPGLNQVYITDENLASLWILKGACANGTGNRCTP*
VAL_1029809	VAL_10298091	F046219	RALDLRAALKLGVRLDLDEIRADEFAAILLIAEEVDVLEKERLSGQMGPR*