Basic Information | |
---|---|
Taxon OID | 3300002893 Open in IMG/M |
Scaffold ID | draft_100021 Open in IMG/M |
Source Dataset Name | PDIso3.OB1V3 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | McGill University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 272132 |
Total Scaffold Genes | 256 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 219 (85.55%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Unclassified → Unclassified → Unclassified → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | British Columbia, Canada | |||||||
Coordinates | Lat. (o) | 51.166666 | Long. (o) | -116.15 | Alt. (m) | Depth (m) | .01 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F032937 | Metagenome / Metatranscriptome | 178 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
draft_10002180 | F032937 | GGAG | LKLVAIKALAGFNYVRPDAVIAIGATDSAKCTIYMTGGVAIPSHEPAKDVIAKLQAAEAEPETN* |
⦗Top⦘ |