Scaffold draft_100010

Overview

Basic Information

• Taxon OID: 3300002893
• Scaffold ID: draft_100010
• Source Dataset Name: PDIso3.OB1V3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: McGill University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 187878
• Total Scaffold Genes: 187
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 154 (82.35%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Unclassified → Unclassified → Unclassified → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location

• Location Name: British Columbia, Canada
• Coordinates
  • Lat. (^o): 51.166666
  • Long. (^o): -116.15
  • Depth (m): .01

Associated Families

Family	Category	Number of Sequences	3D Structure?
F027362	Metagenome / Metatranscriptome	195	Y

Sequences

Protein ID	Family	RBS	Sequence
draft_10001023	F027362	AGGA	MTEAAQRALQAFSKGEMTALELRRRLGGATYGDVLRLLDEASLPLPRAPVHGREASLNIAREWMFPKHVP*