Scaffold Ga0005250J43194_1004889

Overview

Basic Information

• Taxon OID: 3300002883
• Scaffold ID: Ga0005250J43194_1004889
• Source Dataset Name: Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI073_200m_A (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1606
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location

• Location Name: British Columbia, Canada
• Coordinates
  • Lat. (^o): 48.7299
  • Long. (^o): -123.5699

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058538	Metagenome / Metatranscriptome	135	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0005250J43194_10048892	F058538	GGA	MYSQYETTVMNRRRLHHLLSWVNHELHSDYEVIQENRDVFYVIFHDLDILKTVAIQKHLKSNPHTAN*