NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300002883

3300002883: Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI073_200m_A (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300002883 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0046785 | Gp0055361 | Ga0005250
Sample NameMarine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI073_200m_A (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size42830487
Sequencing Scaffolds5
Novel Protein Genes6
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Halieaceae → Luminiphilus → Luminiphilus syltensis1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium1
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomecoastal inletsea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationBritish Columbia, Canada
CoordinatesLat. (o)48.7299Long. (o)-123.5699Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F046847Metagenome / Metatranscriptome150N
F058538Metagenome / Metatranscriptome135N
F061392Metagenome / Metatranscriptome132N
F066454Metagenome / Metatranscriptome126N
F098669Metagenome / Metatranscriptome103N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0005250J43194_1000043Not Available511Open in IMG/M
Ga0005250J43194_1003846All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Halieaceae → Luminiphilus → Luminiphilus syltensis1320Open in IMG/M
Ga0005250J43194_1004889All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium1606Open in IMG/M
Ga0005250J43194_1006079Not Available509Open in IMG/M
Ga0005250J43194_1037320All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales537Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0005250J43194_1000043Ga0005250J43194_10000431F098669METATRGRKQKWRLKEAEGLGRKRRIGETERRELHESDQGLDPGHGLNPGRKVRRIDQAMEGSPEIVPAKIRKKPC
Ga0005250J43194_1003846Ga0005250J43194_10038463F058538GRNMYSQYETTVINRRRLHDILNWVNQKYHLEYEVVQKNRDVFYVIFHDLNIKQTVAIQKQIKGIAQPEHFDMH*
Ga0005250J43194_1004889Ga0005250J43194_10048892F058538MYSQYETTVMNRRRLHHLLSWVNHELHSDYEVIQENRDVFYVIFHDLDILKTVAIQKHLKSNPHTAN*
Ga0005250J43194_1006079Ga0005250J43194_10060791F046847MADEQTEQVETPKTENEVVISQSKLDKLIDKGFSKGANRAKTELADILGVDSIEQARELINAKRETDEANKSDLDKAAELIQTLNSTIDGLESNNKMMVADMAVQKVVTENGIKDADYFKHLLAQASATDDFDQSTFIEQLKGDKPYLFSGGEVQPKKVDATSNRA
Ga0005250J43194_1008288Ga0005250J43194_10082882F066454MSIRLDVLILINSGVTDRSEIMEKLGVNIMSVSNCFRFLIKEGWVEYSREPVSAVGSVGYRITQVGIDKIKASTVDEYRQSPKRKIPDY
Ga0005250J43194_1037320Ga0005250J43194_10373201F061392MICAVFIVGLILSLQSFASGLNEPDPTFKLAATLSPIDGGELYVGDVDRDKQTFRLHLRHIGKNSKWSYYYANAGAFVNEDGDVEPDNAVASIEYPQYTASIIGNTFRKARVRILFSPRGDGKGFFKEAGHVIFQECATKTFEAKNWKCTGWEYLGTLPGF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.