Basic Information | |
---|---|
Taxon OID | 3300002881 Open in IMG/M |
Scaffold ID | Ga0005248J43193_1003946 Open in IMG/M |
Source Dataset Name | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI073_165m_A (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2474 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | British Columbia, Canada | |||||||
Coordinates | Lat. (o) | 48.7299 | Long. (o) | -123.5699 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F066454 | Metagenome / Metatranscriptome | 126 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0005248J43193_10039465 | F066454 | AGGA | MSIRLDVLILINSGVTDRSEIMERLGINIMSVSNCFRFLIKEGWVEYSREPVSAVGSVGYRITQVGIDKIKASTVDEYRQSPKRKIPDYEVMRSHLGVGDDVSRSELINLWNELTDYYLPYEGDKEFTGRRGLSSL* |
⦗Top⦘ |