Scaffold Ga0005243J43192_106315

Overview

Basic Information

• Taxon OID: 3300002876
• Scaffold ID: Ga0005243J43192_106315
• Source Dataset Name: Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI073_120m_B (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1010
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location

• Location Name: British Columbia, Canada
• Coordinates
  • Lat. (^o): 48.7299
  • Long. (^o): -123.5699

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042625	Metagenome / Metatranscriptome	158	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0005243J43192_1063153	F042625	GGA	MTSKEERDQLWKDLKASWAVLKRDSGADEVAKGKAKEKINEIQDALKLDKTDWNQPRSGPPGSHLTKAGASPNPSNNALVEKILGTVLDMKRELNEDLVKINQKL