| Basic Information | |
|---|---|
| Taxon OID | 3300002853 Open in IMG/M |
| Scaffold ID | draft_1004263 Open in IMG/M |
| Source Dataset Name | PDIso9.ppmwps2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | McGill University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1370 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Kootenay National Park, British Columbia | |||||||
| Coordinates | Lat. (o) | 51.17 | Long. (o) | -116.16 | Alt. (m) | Depth (m) | .01 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F028604 | Metagenome / Metatranscriptome | 191 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| draft_10042632 | F028604 | AGGAG | MGACTIGDVSQDFRPVLELNPVDTVGKRLHHDPLHEWGALGHEP* |
| ⦗Top⦘ |