| Basic Information | |
|---|---|
| Family ID | F028604 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 191 |
| Average Sequence Length | 40 residues |
| Representative Sequence | VGAGAIGDVSEDLGPVLELNPVDAVGKRLHHDPLHEWGA |
| Number of Associated Samples | 148 |
| Number of Associated Scaffolds | 191 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 79.06 % |
| % of genes near scaffold ends (potentially truncated) | 44.50 % |
| % of genes from short scaffolds (< 2000 bps) | 76.96 % |
| Associated GOLD sequencing projects | 136 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.17 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.958 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (28.796 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.366 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.068 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.37% β-sheet: 0.00% Coil/Unstructured: 74.63% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.17 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 191 Family Scaffolds |
|---|---|---|
| PF00416 | Ribosomal_S13 | 40.31 |
| PF00557 | Peptidase_M24 | 25.65 |
| PF00406 | ADK | 7.33 |
| PF00411 | Ribosomal_S11 | 6.81 |
| PF00344 | SecY | 4.19 |
| PF00444 | Ribosomal_L36 | 2.09 |
| PF00163 | Ribosomal_S4 | 2.09 |
| PF00572 | Ribosomal_L13 | 1.57 |
| PF01196 | Ribosomal_L17 | 1.57 |
| PF03118 | RNA_pol_A_CTD | 1.05 |
| PF01193 | RNA_pol_L | 1.05 |
| PF00177 | Ribosomal_S7 | 0.52 |
| PF01479 | S4 | 0.52 |
| PF03030 | H_PPase | 0.52 |
| PF01416 | PseudoU_synth_1 | 0.52 |
| PF00589 | Phage_integrase | 0.52 |
| PF00528 | BPD_transp_1 | 0.52 |
| PF00237 | Ribosomal_L22 | 0.52 |
| COG ID | Name | Functional Category | % Frequency in 191 Family Scaffolds |
|---|---|---|---|
| COG0099 | Ribosomal protein S13 | Translation, ribosomal structure and biogenesis [J] | 40.31 |
| COG0563 | Adenylate kinase or related kinase | Nucleotide transport and metabolism [F] | 7.33 |
| COG0100 | Ribosomal protein S11 | Translation, ribosomal structure and biogenesis [J] | 6.81 |
| COG0201 | Preprotein translocase subunit SecY | Intracellular trafficking, secretion, and vesicular transport [U] | 4.19 |
| COG0202 | DNA-directed RNA polymerase, alpha subunit/40 kD subunit | Transcription [K] | 2.09 |
| COG0257 | Ribosomal protein L36 | Translation, ribosomal structure and biogenesis [J] | 2.09 |
| COG0522 | Ribosomal protein S4 or related protein | Translation, ribosomal structure and biogenesis [J] | 2.09 |
| COG0102 | Ribosomal protein L13 | Translation, ribosomal structure and biogenesis [J] | 1.57 |
| COG0203 | Ribosomal protein L17 | Translation, ribosomal structure and biogenesis [J] | 1.57 |
| COG1761 | DNA-directed RNA polymerase, subunit L/RPAC2 | Transcription [K] | 1.05 |
| COG0049 | Ribosomal protein S7 | Translation, ribosomal structure and biogenesis [J] | 0.52 |
| COG0091 | Ribosomal protein L22 | Translation, ribosomal structure and biogenesis [J] | 0.52 |
| COG0101 | tRNA U38,U39,U40 pseudouridine synthase TruA | Translation, ribosomal structure and biogenesis [J] | 0.52 |
| COG3808 | Na+ or H+-translocating membrane pyrophosphatase | Energy production and conversion [C] | 0.52 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.96 % |
| Unclassified | root | N/A | 12.04 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000732|JGI12023J11887_1009125 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300000886|AL3A1W_1065826 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300001086|JGI12709J13192_1016383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 577 | Open in IMG/M |
| 3300001593|JGI12635J15846_10407667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 819 | Open in IMG/M |
| 3300001661|JGI12053J15887_10020421 | All Organisms → cellular organisms → Bacteria | 3705 | Open in IMG/M |
| 3300002853|draft_1004263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 1370 | Open in IMG/M |
| 3300004631|Ga0058899_11824958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 851 | Open in IMG/M |
| 3300005171|Ga0066677_10507633 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300005176|Ga0066679_10658388 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300005454|Ga0066687_10138353 | All Organisms → cellular organisms → Bacteria | 1275 | Open in IMG/M |
| 3300005467|Ga0070706_101599625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 594 | Open in IMG/M |
| 3300005540|Ga0066697_10509442 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300005542|Ga0070732_10366586 | Not Available | 867 | Open in IMG/M |
| 3300005552|Ga0066701_10980324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 500 | Open in IMG/M |
| 3300005553|Ga0066695_10567838 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300005554|Ga0066661_10008172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 5082 | Open in IMG/M |
| 3300005557|Ga0066704_10097456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1926 | Open in IMG/M |
| 3300005557|Ga0066704_10396741 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300006028|Ga0070717_10154608 | All Organisms → cellular organisms → Bacteria | 1986 | Open in IMG/M |
| 3300006032|Ga0066696_10226106 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
| 3300006059|Ga0075017_100877213 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300006173|Ga0070716_100194560 | All Organisms → cellular organisms → Bacteria | 1343 | Open in IMG/M |
| 3300006794|Ga0066658_10694530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 561 | Open in IMG/M |
| 3300006797|Ga0066659_10065129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2361 | Open in IMG/M |
| 3300006800|Ga0066660_10685188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 845 | Open in IMG/M |
| 3300007076|Ga0075435_100140037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2029 | Open in IMG/M |
| 3300007255|Ga0099791_10013673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 3430 | Open in IMG/M |
| 3300007258|Ga0099793_10055792 | All Organisms → cellular organisms → Bacteria | 1756 | Open in IMG/M |
| 3300007258|Ga0099793_10186715 | Not Available | 991 | Open in IMG/M |
| 3300007258|Ga0099793_10256080 | Not Available | 846 | Open in IMG/M |
| 3300007265|Ga0099794_10138984 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
| 3300009029|Ga0066793_10079403 | All Organisms → cellular organisms → Bacteria | 1885 | Open in IMG/M |
| 3300009038|Ga0099829_10600100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 915 | Open in IMG/M |
| 3300009038|Ga0099829_10873832 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300009038|Ga0099829_10932163 | Not Available | 720 | Open in IMG/M |
| 3300009038|Ga0099829_10959987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 709 | Open in IMG/M |
| 3300009088|Ga0099830_10682230 | Not Available | 845 | Open in IMG/M |
| 3300009088|Ga0099830_11659524 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300009088|Ga0099830_11686401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 529 | Open in IMG/M |
| 3300009089|Ga0099828_10194035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1810 | Open in IMG/M |
| 3300009089|Ga0099828_10295444 | All Organisms → cellular organisms → Bacteria | 1457 | Open in IMG/M |
| 3300009090|Ga0099827_10023020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 4364 | Open in IMG/M |
| 3300009090|Ga0099827_10415392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1151 | Open in IMG/M |
| 3300009090|Ga0099827_11055560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 705 | Open in IMG/M |
| 3300009090|Ga0099827_11812947 | Not Available | 532 | Open in IMG/M |
| 3300009137|Ga0066709_101312658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1060 | Open in IMG/M |
| 3300009651|Ga0105859_1119330 | Not Available | 724 | Open in IMG/M |
| 3300010048|Ga0126373_11449147 | Not Available | 752 | Open in IMG/M |
| 3300010075|Ga0127434_119494 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300010088|Ga0127476_1029799 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300010090|Ga0127471_1022164 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300010096|Ga0127473_1005690 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300010105|Ga0127470_1094521 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300010111|Ga0127491_1107359 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300010114|Ga0127460_1118175 | Not Available | 850 | Open in IMG/M |
| 3300010125|Ga0127443_1082541 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300010128|Ga0127486_1148658 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300010141|Ga0127499_1197000 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300010320|Ga0134109_10030635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1707 | Open in IMG/M |
| 3300010358|Ga0126370_10145622 | All Organisms → cellular organisms → Bacteria | 1719 | Open in IMG/M |
| 3300010398|Ga0126383_11081279 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300010860|Ga0126351_1275488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 520 | Open in IMG/M |
| 3300011120|Ga0150983_15548239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 877 | Open in IMG/M |
| 3300011270|Ga0137391_10043642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 3805 | Open in IMG/M |
| 3300011270|Ga0137391_10491949 | Not Available | 1039 | Open in IMG/M |
| 3300011270|Ga0137391_10570582 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300011271|Ga0137393_10729274 | Not Available | 848 | Open in IMG/M |
| 3300011271|Ga0137393_10776711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 819 | Open in IMG/M |
| 3300011271|Ga0137393_10834973 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300011271|Ga0137393_10912872 | Not Available | 749 | Open in IMG/M |
| 3300011987|Ga0120164_1041480 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300011991|Ga0120153_1000169 | All Organisms → cellular organisms → Bacteria | 37868 | Open in IMG/M |
| 3300011991|Ga0120153_1001219 | All Organisms → cellular organisms → Bacteria | 12353 | Open in IMG/M |
| 3300011997|Ga0120162_1089393 | Not Available | 660 | Open in IMG/M |
| 3300012005|Ga0120161_1052621 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300012011|Ga0120152_1022411 | All Organisms → cellular organisms → Bacteria | 2354 | Open in IMG/M |
| 3300012019|Ga0120139_1002250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 5304 | Open in IMG/M |
| 3300012096|Ga0137389_10418581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1145 | Open in IMG/M |
| 3300012198|Ga0137364_10114725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1913 | Open in IMG/M |
| 3300012200|Ga0137382_10055347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2492 | Open in IMG/M |
| 3300012203|Ga0137399_10455602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus | 1070 | Open in IMG/M |
| 3300012203|Ga0137399_10667554 | Not Available | 875 | Open in IMG/M |
| 3300012203|Ga0137399_10775342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 807 | Open in IMG/M |
| 3300012203|Ga0137399_10837222 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300012206|Ga0137380_10136185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2241 | Open in IMG/M |
| 3300012211|Ga0137377_10087872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2933 | Open in IMG/M |
| 3300012211|Ga0137377_10260383 | All Organisms → cellular organisms → Bacteria | 1665 | Open in IMG/M |
| 3300012357|Ga0137384_11070102 | Not Available | 647 | Open in IMG/M |
| 3300012359|Ga0137385_10001927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 17577 | Open in IMG/M |
| 3300012359|Ga0137385_11589586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 518 | Open in IMG/M |
| 3300012361|Ga0137360_10465854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1072 | Open in IMG/M |
| 3300012363|Ga0137390_10162077 | All Organisms → cellular organisms → Bacteria | 2224 | Open in IMG/M |
| 3300012363|Ga0137390_11245956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 690 | Open in IMG/M |
| 3300012372|Ga0134037_1057613 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300012374|Ga0134039_1097063 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300012374|Ga0134039_1245306 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300012375|Ga0134034_1029005 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300012377|Ga0134029_1074116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 542 | Open in IMG/M |
| 3300012381|Ga0134026_1128076 | Not Available | 609 | Open in IMG/M |
| 3300012382|Ga0134038_1164928 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300012382|Ga0134038_1273758 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300012383|Ga0134033_1109566 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300012383|Ga0134033_1138031 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300012383|Ga0134033_1270926 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300012389|Ga0134040_1082245 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300012389|Ga0134040_1177815 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300012389|Ga0134040_1254578 | Not Available | 593 | Open in IMG/M |
| 3300012389|Ga0134040_1285391 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300012405|Ga0134041_1247603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 506 | Open in IMG/M |
| 3300012405|Ga0134041_1295923 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300012409|Ga0134045_1283584 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300012685|Ga0137397_11002653 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300012917|Ga0137395_10196281 | All Organisms → cellular organisms → Bacteria | 1403 | Open in IMG/M |
| 3300012918|Ga0137396_10221685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1393 | Open in IMG/M |
| 3300012923|Ga0137359_10140480 | All Organisms → cellular organisms → Bacteria | 2150 | Open in IMG/M |
| 3300012925|Ga0137419_10479053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 985 | Open in IMG/M |
| 3300012929|Ga0137404_11103130 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300012957|Ga0164303_10211095 | Not Available | 1083 | Open in IMG/M |
| 3300012960|Ga0164301_10902863 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300013427|Ga0120106_1083056 | Not Available | 565 | Open in IMG/M |
| 3300013763|Ga0120179_1143502 | Not Available | 520 | Open in IMG/M |
| 3300014154|Ga0134075_10242779 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300015164|Ga0167652_1013752 | All Organisms → cellular organisms → Bacteria | 1716 | Open in IMG/M |
| 3300018071|Ga0184618_10011652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2676 | Open in IMG/M |
| 3300018431|Ga0066655_10074395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1831 | Open in IMG/M |
| 3300018433|Ga0066667_10011025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 4354 | Open in IMG/M |
| 3300018468|Ga0066662_11065230 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300018482|Ga0066669_10115123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1902 | Open in IMG/M |
| 3300019866|Ga0193756_1000825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2782 | Open in IMG/M |
| 3300019882|Ga0193713_1123272 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300019883|Ga0193725_1035509 | All Organisms → cellular organisms → Bacteria | 1316 | Open in IMG/M |
| 3300020001|Ga0193731_1019951 | All Organisms → cellular organisms → Bacteria | 1749 | Open in IMG/M |
| 3300021046|Ga0215015_10179899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1515 | Open in IMG/M |
| 3300021088|Ga0210404_10517531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 675 | Open in IMG/M |
| 3300021088|Ga0210404_10862426 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300021307|Ga0179585_1153766 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300021432|Ga0210384_10210647 | All Organisms → cellular organisms → Bacteria | 1748 | Open in IMG/M |
| 3300021432|Ga0210384_10557503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1030 | Open in IMG/M |
| 3300021479|Ga0210410_10111652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2419 | Open in IMG/M |
| 3300021861|Ga0213853_10495901 | All Organisms → cellular organisms → Bacteria | 1603 | Open in IMG/M |
| 3300022506|Ga0242648_1071316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 565 | Open in IMG/M |
| 3300022557|Ga0212123_10000044 | All Organisms → cellular organisms → Bacteria | 392379 | Open in IMG/M |
| 3300022691|Ga0248483_111963 | All Organisms → cellular organisms → Bacteria | 2130 | Open in IMG/M |
| 3300025505|Ga0207929_1003867 | All Organisms → cellular organisms → Bacteria | 3109 | Open in IMG/M |
| 3300025505|Ga0207929_1008586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1958 | Open in IMG/M |
| 3300025862|Ga0209483_1194224 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300025910|Ga0207684_10000002 | All Organisms → cellular organisms → Bacteria | 1042751 | Open in IMG/M |
| 3300025922|Ga0207646_10077525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2970 | Open in IMG/M |
| 3300025922|Ga0207646_10094324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2680 | Open in IMG/M |
| 3300025922|Ga0207646_10230535 | All Organisms → cellular organisms → Bacteria | 1673 | Open in IMG/M |
| 3300025929|Ga0207664_11046666 | Not Available | 731 | Open in IMG/M |
| 3300026295|Ga0209234_1011123 | All Organisms → cellular organisms → Bacteria | 3416 | Open in IMG/M |
| 3300026309|Ga0209055_1029997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2497 | Open in IMG/M |
| 3300026310|Ga0209239_1145573 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300026318|Ga0209471_1000389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 30668 | Open in IMG/M |
| 3300026318|Ga0209471_1118755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus | 1127 | Open in IMG/M |
| 3300026320|Ga0209131_1006149 | All Organisms → cellular organisms → Bacteria | 7705 | Open in IMG/M |
| 3300026322|Ga0209687_1086460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1020 | Open in IMG/M |
| 3300026328|Ga0209802_1008194 | All Organisms → cellular organisms → Bacteria | 6366 | Open in IMG/M |
| 3300026343|Ga0209159_1001779 | All Organisms → cellular organisms → Bacteria | 15889 | Open in IMG/M |
| 3300026351|Ga0257170_1011996 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300026376|Ga0257167_1063187 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300026469|Ga0257169_1036791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 745 | Open in IMG/M |
| 3300026528|Ga0209378_1028834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 2950 | Open in IMG/M |
| 3300026551|Ga0209648_10026947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 5024 | Open in IMG/M |
| 3300027383|Ga0209213_1028337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1056 | Open in IMG/M |
| 3300027546|Ga0208984_1013894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1574 | Open in IMG/M |
| 3300027587|Ga0209220_1012840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2231 | Open in IMG/M |
| 3300027655|Ga0209388_1024075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1720 | Open in IMG/M |
| 3300027674|Ga0209118_1002225 | All Organisms → cellular organisms → Bacteria | 8461 | Open in IMG/M |
| 3300027678|Ga0209011_1077256 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300027681|Ga0208991_1026780 | All Organisms → cellular organisms → Bacteria | 1744 | Open in IMG/M |
| 3300027681|Ga0208991_1091198 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300027681|Ga0208991_1152299 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300027846|Ga0209180_10010531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 4768 | Open in IMG/M |
| 3300027846|Ga0209180_10224542 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300027846|Ga0209180_10264022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 989 | Open in IMG/M |
| 3300027857|Ga0209166_10016987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 4590 | Open in IMG/M |
| 3300027875|Ga0209283_10010770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli | 5413 | Open in IMG/M |
| 3300027882|Ga0209590_10009344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 4507 | Open in IMG/M |
| 3300027915|Ga0209069_11007985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 511 | Open in IMG/M |
| 3300028536|Ga0137415_10253201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1569 | Open in IMG/M |
| 3300028792|Ga0307504_10078421 | Not Available | 1009 | Open in IMG/M |
| 3300029636|Ga0222749_10107939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales | 1315 | Open in IMG/M |
| 3300030903|Ga0308206_1169662 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300031640|Ga0318555_10765418 | Not Available | 521 | Open in IMG/M |
| 3300031670|Ga0307374_10000450 | All Organisms → cellular organisms → Bacteria | 79503 | Open in IMG/M |
| 3300031753|Ga0307477_10053361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2780 | Open in IMG/M |
| 3300032180|Ga0307471_100185424 | All Organisms → cellular organisms → Bacteria | 2059 | Open in IMG/M |
| 3300032180|Ga0307471_100414862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Alicyclobacillaceae | 1477 | Open in IMG/M |
| 3300032205|Ga0307472_100100200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1990 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 28.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 15.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.95% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.28% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 5.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.71% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.66% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.09% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.57% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.57% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.05% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.05% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.52% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.52% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.52% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.52% |
| Hydrocarbon Resource Environments | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Hydrocarbon Resource Environments | 0.52% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.52% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.52% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.52% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.52% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.52% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000732 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 | Environmental | Open in IMG/M |
| 3300000886 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-65cm-3A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001086 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002853 | PDIso9.ppmwps2 | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009651 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-063 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010075 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010088 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010090 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010096 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010105 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010111 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010114 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010125 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010128 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010141 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010860 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011987 | Permafrost microbial communities from Nunavut, Canada - A20_80cm_0M | Environmental | Open in IMG/M |
| 3300011991 | Permafrost microbial communities from Nunavut, Canada - A34_65cm_12M | Environmental | Open in IMG/M |
| 3300011997 | Permafrost microbial communities from Nunavut, Canada - A15_80cm_18M | Environmental | Open in IMG/M |
| 3300012005 | Permafrost microbial communities from Nunavut, Canada - A15_80cm_0M | Environmental | Open in IMG/M |
| 3300012011 | Permafrost microbial communities from Nunavut, Canada - A30_65cm_6M | Environmental | Open in IMG/M |
| 3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012372 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012374 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012375 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012377 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012381 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012382 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012383 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012389 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012405 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012409 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300013427 | Permafrost microbial communities from Nunavut, Canada - A15_35cm_18M | Environmental | Open in IMG/M |
| 3300013763 | Permafrost microbial communities from Nunavut, Canada - A15_65cm_0M | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300015164 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4b, rock/ice/stream interface) | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019866 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021307 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022506 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022691 | Soil microbial communities from Calhoun CZO, South Carolina, United States - 60cm depth | Environmental | Open in IMG/M |
| 3300025505 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025862 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026351 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B | Environmental | Open in IMG/M |
| 3300026376 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-B | Environmental | Open in IMG/M |
| 3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12023J11887_10091253 | 3300000732 | Forest Soil | MGACTIGDVSQDFRPVLELNPVYAVGERLHHDPLHE* |
| AL3A1W_10658262 | 3300000886 | Permafrost | VGACTIGDVSQDFRPVLELNPVDTVGKRLHHDPLHEWEALGHERRLYQTPGDGG* |
| JGI12709J13192_10163831 | 3300001086 | Forest Soil | VGACTIGDVSQDLGPVLELNPVNAVGKRLYHDPLHERGALGHER* |
| JGI12635J15846_104076672 | 3300001593 | Forest Soil | MGACTIGDVSQDFRPVLELNPVYAVGERLHHDPLHD* |
| JGI12053J15887_100204214 | 3300001661 | Forest Soil | MGACTIGDVSQDLSPVLELHPVHAVGKRLHDDPLHERGALGHER* |
| draft_10042632 | 3300002853 | Hydrocarbon Resource Environments | MGACTIGDVSQDFRPVLELNPVDTVGKRLHHDPLHEWGALGHEP* |
| Ga0058899_118249582 | 3300004631 | Forest Soil | MGAGAVGDVSEDLGPVLELDPVHAVGKRLHHDPLHERGALGHERRVYQSLC* |
| Ga0066677_105076331 | 3300005171 | Soil | VGAETVGDVGEDQRPVLELNPIHTVGKRLFDDPLHEWGAWGHE |
| Ga0066679_106583881 | 3300005176 | Soil | VGAEAVGDVSEDLGPVLELDPIDTIGKRLHHDPLHEWGALGHE |
| Ga0066687_101383531 | 3300005454 | Soil | PGEVGAETVGDVGEDQRPVLELNPIHTVGKRLFDDPLHEWGAWGHERRVYQRPD* |
| Ga0070706_1015996252 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | GTIGDVSEDLRPVLELNPVDTVGKRLHHDPLHEWGALGHEA* |
| Ga0066697_105094422 | 3300005540 | Soil | VGAGPIGDVGEDLRPILELNPVHAVGKRLHHDPLH |
| Ga0070732_103665861 | 3300005542 | Surface Soil | MGAGAIGDVGEDLRPVLELNPVETVGQRLHHDPLHE* |
| Ga0066701_109803242 | 3300005552 | Soil | VGAGTIGDVSEDLGPVLELNPVDTVGKRLHHDPLHEWGALGHEW* |
| Ga0066695_105678381 | 3300005553 | Soil | VGAGAIGDVGEDFRPVLELNPVHAVGKRLHHDPLHE |
| Ga0066661_100081724 | 3300005554 | Soil | MGAGAIGDVGEDLRPVLELNPVDAVGKRLHHDPLHE* |
| Ga0066704_100974561 | 3300005557 | Soil | TIGDVSEDLGPVLELNPVDTVGKRLHHDPLHEWGALGHER* |
| Ga0066704_103967411 | 3300005557 | Soil | VGAGAIGHVSEDLRPVLELNPVDAVGKRLHHDPLHEWGALGHE |
| Ga0070717_101546081 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VGAGTIGDVSEDLGPVLELNPVDTVGKRLHHDPLHE |
| Ga0066696_102261062 | 3300006032 | Soil | VGAGAIGNVGQDLGPILELNPVYTVGKRLQDDPLYE* |
| Ga0075017_1008772132 | 3300006059 | Watersheds | MGACAIGDVSEDLGPVFELNPVDAVGKRLHHDPLHEWGALGHER* |
| Ga0070716_1001945603 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VGACTIGDVSQDLGPVLELNPVNAVGKRFDHDPLHERGALGHER* |
| Ga0066658_106945302 | 3300006794 | Soil | MGARAIGNVSEDLGPVLELNPVDAVGKRLHHDPLHE* |
| Ga0066659_100651295 | 3300006797 | Soil | MGACAIGDVSEDLRPVLELNPIDTVGKGLYDDPLHEWGALGHE |
| Ga0066660_106851883 | 3300006800 | Soil | MGAGAIGDVGEDLRPVLELNPVDTVGKRLHHDPLHE |
| Ga0075435_1001400373 | 3300007076 | Populus Rhizosphere | MGACAIGDVSEDLRPVLELNPVDAVGKRLHHDPLHE* |
| Ga0099791_100136733 | 3300007255 | Vadose Zone Soil | VGAGAIGNVSEDLGPVLELNPVDAVGKRLHHDPLHE* |
| Ga0099793_100557924 | 3300007258 | Vadose Zone Soil | GEEPGEVGAGTIGHMSEDLRPVLELNPVDAVGKRLHHDPLHEWGALGHEL* |
| Ga0099793_101867152 | 3300007258 | Vadose Zone Soil | GQQPGKVGACAIGDVSQDLGPVLELNPVDAVGQRFDHDPLHERGTLGHER* |
| Ga0099793_102560802 | 3300007258 | Vadose Zone Soil | REVGAGTIGDVSEDFGPVLELNPVDTIGKRLHHDPLHEWGALGHER* |
| Ga0099794_101389842 | 3300007265 | Vadose Zone Soil | VGAGTIGYVGQDLGPVLELNPVYTVGKRLQDDPLDE* |
| Ga0066793_100794033 | 3300009029 | Prmafrost Soil | VGACTIGDVSQDLGPVLELNPVDAVGKRLDHDPLHERGALGHER* |
| Ga0099829_106001002 | 3300009038 | Vadose Zone Soil | VGAGTIGHVSEDLGPVLELNPVDAVGKRLHHDPLHEWGALGHEP* |
| Ga0099829_108738322 | 3300009038 | Vadose Zone Soil | VGAGAIGHVSEDLGPVLELNPIDAVGKRLHHGPLHEWGALGHEP* |
| Ga0099829_109321632 | 3300009038 | Vadose Zone Soil | DVSEDLRPVLELNPVDTVGKRLHHDPLHEWGALGHER* |
| Ga0099829_109599872 | 3300009038 | Vadose Zone Soil | VGAGTIGDMSEDLRPVLELNPVDTVGKRLHHDPLHEWEALGHEP* |
| Ga0099830_106822302 | 3300009088 | Vadose Zone Soil | AGAIGHVSEDLGPVLELNPVDAVGKRLHHDPLHEWEALGHEP* |
| Ga0099830_116595241 | 3300009088 | Vadose Zone Soil | VGAGTIGDVSEDLRPVLELNPVDTVGKRLHHDPLHEW |
| Ga0099830_116864012 | 3300009088 | Vadose Zone Soil | EVGAGAIGHVSEDLGPVLELNPVDAVGKRLHHDPLHEWGALGHEP* |
| Ga0099828_101940353 | 3300009089 | Vadose Zone Soil | VGAGAIGHVSEDLGPVLELNPVDAVGKRLHHDPLHE* |
| Ga0099828_102954441 | 3300009089 | Vadose Zone Soil | PGEVGAGAIGHVSEDLGPVLELNPVDAVGKRLHHDPLHEWEALGHEP* |
| Ga0099827_100230204 | 3300009090 | Vadose Zone Soil | MSEDLGPVLELNPVDAVGKRLHHDPLHEWGALGHEP* |
| Ga0099827_104153922 | 3300009090 | Vadose Zone Soil | VGAGAIGNVSEDLGPVLELDPVDAVGKRLHHDPLHE* |
| Ga0099827_110555601 | 3300009090 | Vadose Zone Soil | PCEVGAGTIGDVSEDLRPVLELNPVDTVGKRLHHDPLHEWGALGHET* |
| Ga0099827_118129472 | 3300009090 | Vadose Zone Soil | VGAGAIGYVGQDLGPVLELNPVYTVGKRLQDDPLDE* |
| Ga0066709_1013126582 | 3300009137 | Grasslands Soil | VGAGAIGNVGQDLGPILELNPVYAVGKRLQDDPLYE* |
| Ga0105859_11193301 | 3300009651 | Permafrost Soil | VGACAIGDVSQDLSPVLELNPVNAVGKRFDHDPLHERGALGH* |
| Ga0126373_114491472 | 3300010048 | Tropical Forest Soil | VGAGAIGDVSEDFGPVLELNPIDTVGKRLHHDPLHE* |
| Ga0127434_1194941 | 3300010075 | Grasslands Soil | MGARAIGDVSEDLRPVLELNPVDTVGKRLYHDPLHE* |
| Ga0127476_10297991 | 3300010088 | Grasslands Soil | MGAETIGDVSEDLRPVFELDPVHTVGQRLDHDPLHEWG |
| Ga0127471_10221642 | 3300010090 | Grasslands Soil | VGAGAIGNVGQDLGPILELNPVHTVGKRLQDDPLYE* |
| Ga0127473_10056901 | 3300010096 | Grasslands Soil | VGGQAIGDVSEDQRPVFELNPIHTVGKGLYDDPLHEWG |
| Ga0127470_10945211 | 3300010105 | Grasslands Soil | MGAETIGDVSEDLRPVLQLDPVHTVGQRLDHDPLHEWGAL |
| Ga0127491_11073591 | 3300010111 | Grasslands Soil | VGAGAIGNVGQDLGPVLELNPVYTVGKRLQDDPLDE* |
| Ga0127460_11181751 | 3300010114 | Grasslands Soil | VGAGAVGDVGEDFRPVLELNPVDAIGKRLHHDPLHE* |
| Ga0127443_10825411 | 3300010125 | Grasslands Soil | VGGQAIGDVSEDQRPVFELNPIHTVGKGLYDDPLHEWGALGHERRLYQSRG |
| Ga0127486_11486582 | 3300010128 | Grasslands Soil | VGASAIGDVSEDLRPVLELNPVNTVRKRLHHDPLHE* |
| Ga0127499_11970001 | 3300010141 | Grasslands Soil | VGACTIGDVSQDLRPVLELNPVHTVGKRLHDDPLHERGT |
| Ga0134109_100306352 | 3300010320 | Grasslands Soil | VGAGAIGDVSEDLRPVLELNPVDAVGKRLHHDPLHE* |
| Ga0126370_101456221 | 3300010358 | Tropical Forest Soil | KPREVGAGAIGNVGEDLGPVLELNPVDTVGKRLHHDPLHE* |
| Ga0126383_110812792 | 3300010398 | Tropical Forest Soil | VGAGAIGNVGEDLGPVLQLNPVYAVRQRLEHDPLDE* |
| Ga0126351_12754881 | 3300010860 | Boreal Forest Soil | VGAGAIGHVSEDLGPVLELNPVDAVGKRLHHDPLHD* |
| Ga0150983_155482392 | 3300011120 | Forest Soil | MGAGTIGNVSEDFRPVFELNPVDAVGKRLHHDPLHERGTLGHER* |
| Ga0137391_100436422 | 3300011270 | Vadose Zone Soil | VGAGAIGHVSEDLGPVFELNPVDAVGKRLHHDPLHE* |
| Ga0137391_104919491 | 3300011270 | Vadose Zone Soil | IGHVSEDLGPVLELNPVDAVGKRLHHDPLHEWGALGHEP* |
| Ga0137391_105705822 | 3300011270 | Vadose Zone Soil | VGAGTIGDMSEDLRPVLELNPVDTVGKRLHHDPLHEWEALGHER* |
| Ga0137393_107292742 | 3300011271 | Vadose Zone Soil | MGAYAIGDVSEDHCPVLELNPVDTVGKRLHHDPLHE* |
| Ga0137393_107767113 | 3300011271 | Vadose Zone Soil | MSEDLRPVLELNPVDTVGKRLHHDPLHEWEALGHEP* |
| Ga0137393_108349731 | 3300011271 | Vadose Zone Soil | VGAGTIGDVSEDFGPVLELNPVDTIGKRLHHDPLHEWGALGHER* |
| Ga0137393_109128721 | 3300011271 | Vadose Zone Soil | VGAGTIGDVSEDLRPVLELNPVDTVGKRLHHDPLHEWGALGHER* |
| Ga0120164_10414802 | 3300011987 | Permafrost | VGACTIGDVSQDLSPVLELNPINAVGKRLDHDPLHERGALGHER* |
| Ga0120153_100016927 | 3300011991 | Permafrost | VGACTIGDVSQDLGPVLELNPIYAVGKRLHHDPLHERGALGHER* |
| Ga0120153_100121911 | 3300011991 | Permafrost | VGACTIGDVSQDLGPVLELNPVNAVGKRLDHDPLHERGALGHER* |
| Ga0120162_10893932 | 3300011997 | Permafrost | QDLSPVLKLNPVNAIGKRLDHDPLHERGALGHER* |
| Ga0120161_10526211 | 3300012005 | Permafrost | VGACTIGDVSQDLSPVLKLNPVNAIGKRLDHDPLHERGALGHER* |
| Ga0120152_10224114 | 3300012011 | Permafrost | EKPGEVGTCTIGDVSQDLGPVLELNPIYAVGKRLHHDPLHERGALGHER* |
| Ga0120139_10022505 | 3300012019 | Permafrost | VGACTIGDVSQDFRPVLELNPVDTVGKRLHHDPLHEWEALGHERRLYQTPGNGG* |
| Ga0137389_104185811 | 3300012096 | Vadose Zone Soil | VGAGAIGYVGQDLGPVLELNPVYTVGKRLQDDPLNE* |
| Ga0137364_101147254 | 3300012198 | Vadose Zone Soil | MGARAIGDVGEDLRPVLELNPVDTVGKRLHHDPLHE* |
| Ga0137382_100553471 | 3300012200 | Vadose Zone Soil | PGEMGARAIGDVSEDLRPVLELNPVDTVGKRLHHDPLHE* |
| Ga0137399_104556021 | 3300012203 | Vadose Zone Soil | VGAGAIGDVSEDLGPVFELNPVDAVGKRLHHDPLHE* |
| Ga0137399_106675541 | 3300012203 | Vadose Zone Soil | KVGACAIGDVSQDLGPVLELNPVDAVGKRFDHDPLHERGALGHER* |
| Ga0137399_107753422 | 3300012203 | Vadose Zone Soil | MAAYAIGDVSEDHCPVLELNPIDAVGKRLHHDPLHE* |
| Ga0137399_108372221 | 3300012203 | Vadose Zone Soil | VGAGTIGDVSEDLGPVLELNPVDTIGKRLHHDPLHEWGALGHERR |
| Ga0137380_101361854 | 3300012206 | Vadose Zone Soil | MGARAIGDVSEDLRPVLELNPVDTVGKRLHHDPLHE* |
| Ga0137377_100878724 | 3300012211 | Vadose Zone Soil | VGAGAIGDVSEDLGPVLELNPVDAVGKRLHHDPLHE* |
| Ga0137377_102603832 | 3300012211 | Vadose Zone Soil | VGAGTIGDMSEDLRPVLELNPVDTVGKRLHHDPLHEWGALGHEP* |
| Ga0137384_110701021 | 3300012357 | Vadose Zone Soil | SEDLGPVLELNPVDAVGKRLHHDPLHEWGALGHEP* |
| Ga0137385_100019271 | 3300012359 | Vadose Zone Soil | EPGEVGAGTIGDVSEDLGPVLELNPVDAVGKRLHHDPLHE* |
| Ga0137385_115895861 | 3300012359 | Vadose Zone Soil | VGAGAIGNVGQDLGPILELNPVHTVGKRLQDDPLDE* |
| Ga0137360_104658543 | 3300012361 | Vadose Zone Soil | MGARAIGDVSEDLRPVLELNPVDAVGKRLHYDPLHE* |
| Ga0137390_101620774 | 3300012363 | Vadose Zone Soil | VGAGAIGDVSEDLGPVLELNPVDAVGKRLHHDPLHEWGALGHER* |
| Ga0137390_112459561 | 3300012363 | Vadose Zone Soil | PCEVGAGTIGDMSEDLRPVLELNPVDTVGKRLHHDPLHEWEALGHEP* |
| Ga0134037_10576132 | 3300012372 | Grasslands Soil | MGARTIGDVSEDLGPVLELDPIDTIGKRLHHDPLHEWGAL |
| Ga0134039_10970631 | 3300012374 | Grasslands Soil | VGGQAIGDVSEDQRPVFELNPIHTVGKGLYDDPLHEWGA |
| Ga0134039_12453062 | 3300012374 | Grasslands Soil | MGARTIGDVGEDLGPVLELDPIDTIGKRLHHDPLHE |
| Ga0134034_10290052 | 3300012375 | Grasslands Soil | MGACAIGDVSEDLRPVLELNPIDTVGKGLYDDPLH |
| Ga0134029_10741161 | 3300012377 | Grasslands Soil | VGGQAIGDVSEDQRPVFELNPIHTVGKGLYDDPLHE* |
| Ga0134026_11280762 | 3300012381 | Grasslands Soil | MGARTIGDVSEDLGPVLELDPIDTIGKRLHHDPLHE* |
| Ga0134038_11649281 | 3300012382 | Grasslands Soil | MGARTIGDVSEDLGPVLELDPIDTIGKRLHHDPLHE |
| Ga0134038_12737581 | 3300012382 | Grasslands Soil | VGAETVGDVGEDQRPVLELNPIHTVGKRLFDDPLHEWGA |
| Ga0134033_11095661 | 3300012383 | Grasslands Soil | VGGQAIGDVSEDQRPVFELNPIHTVGKGLYDDPLHEWGALG |
| Ga0134033_11380312 | 3300012383 | Grasslands Soil | VGAGAIGNVSQDLGPVLELNPVDAVGKRLQHDPLH |
| Ga0134033_12709261 | 3300012383 | Grasslands Soil | MGAETIGDVSEDLRPVFELDPVHTVGQRLDHDPLHEWGAL |
| Ga0134040_10822452 | 3300012389 | Grasslands Soil | MGARTIGDVSEDLGPVLELDPIDTIGKRLHHDPLHEWGALGHE |
| Ga0134040_11778151 | 3300012389 | Grasslands Soil | MGARAIGDVSEDLRPVLELNPVDTVRKRLHHDPLHEW |
| Ga0134040_12545781 | 3300012389 | Grasslands Soil | MGACAIGDVSEDLRPVLELNPIDTVGKGLYDDPLHEWGA |
| Ga0134040_12853912 | 3300012389 | Grasslands Soil | VGGQAVGDVSEDQRPVFELNPIHTVGKGLYDDPLHEWGA |
| Ga0134041_12476031 | 3300012405 | Grasslands Soil | MGACAIGDVSEDLRPVLELNPIDTVGKGLYDDPLHEWGALGHEPRLYQTA |
| Ga0134041_12959232 | 3300012405 | Grasslands Soil | VGGQAIGDVSEDQRPVFELNPIHTVGKGLYDDPLHEWGALGHERRLYQ |
| Ga0134045_12835841 | 3300012409 | Grasslands Soil | VGAGTIGDVSEDLGPVLELNPVDAVGKRLHDDPLHEW |
| Ga0137397_110026532 | 3300012685 | Vadose Zone Soil | VGGQAIGDGSEDQRPVFELNPIHAVGKGLYDDPLHEWGAL |
| Ga0137395_101962813 | 3300012917 | Vadose Zone Soil | EDLRPVLELNPVDTIGKRLHHDPLHEWGALGHER* |
| Ga0137396_102216854 | 3300012918 | Vadose Zone Soil | VGAGAIGDVSEDLGPVLELNPVDAVGKRLHHDPLHEWGA |
| Ga0137359_101404804 | 3300012923 | Vadose Zone Soil | SEDLRPVLELNPVDAVGKRLHHDPLHEWGALGHEL* |
| Ga0137419_104790532 | 3300012925 | Vadose Zone Soil | MGACTIGDVSQDLGPVLELNPVNAVGKRLHDDPLHERGALGHER* |
| Ga0137404_111031301 | 3300012929 | Vadose Zone Soil | VGACTIGDVSQDLGPVLELNPVNAVGKRFDHDPLHERGA |
| Ga0164303_102110952 | 3300012957 | Soil | VGACTIGDVSQDFGPVLELNPVNAVGKRFDHDPLHERGALGHER* |
| Ga0164301_109028632 | 3300012960 | Soil | MGACTIGDVSQDFRPVFELNPVYAVGERLHHDPLHE* |
| Ga0120106_10830562 | 3300013427 | Permafrost | SQEPGKVGACTIGDVSQDLSPVLELNPVNAIGKRLDHDPLHERGALGHER* |
| Ga0120179_11435022 | 3300013763 | Permafrost | QALGPVLELNPVHTVGKRLHHDPLHERGALGHER* |
| Ga0134075_102427792 | 3300014154 | Grasslands Soil | MGARAIGDVSEDLRPVLELNPVHTVGKRLHHDPLHE* |
| Ga0167652_10137523 | 3300015164 | Glacier Forefield Soil | VGACTIGDVSQDLSPVLELNPVNAVGKRFDHDPLHERGALGHER* |
| Ga0184618_100116522 | 3300018071 | Groundwater Sediment | MGACTIGDVSQDFRPVLELNPVYAVGERLHHDPLHE |
| Ga0066655_100743954 | 3300018431 | Grasslands Soil | MGARAIGDVSEDLRPVLELNPVDTVGKRLHHDPLHE |
| Ga0066667_100110251 | 3300018433 | Grasslands Soil | VGAGAIGNVGQDLGPILELNPVYAVGKRLQDDPLYE |
| Ga0066662_110652303 | 3300018468 | Grasslands Soil | VGAGAIGNVGQDLGPVLELNPVYTVGKRLQDDPLDE |
| Ga0066669_101151235 | 3300018482 | Grasslands Soil | VGAGAIGNVGQDLGPILELNPVHTVGKRLQDDPLYE |
| Ga0193756_10008252 | 3300019866 | Soil | MGACTIGDVSQDFRPVLELNPVHTVGERLHHDPLHE |
| Ga0193713_11232722 | 3300019882 | Soil | MGACTIGDVSQDLRPVLELNPVYAVGKRLHDDPLHERGALGH |
| Ga0193725_10355093 | 3300019883 | Soil | VSQDLGPVLELNPVNAVGKRLHHDPLHERGALGHER |
| Ga0193731_10199511 | 3300020001 | Soil | GDVSQDLGPVLELNPVNAVGQRLHHDPLHERGALGHER |
| Ga0215015_101798995 | 3300021046 | Soil | VGAGTIGDVSEDLRPVLELNPVDTVGKRLHHDPLHEWGALGHE |
| Ga0210404_105175312 | 3300021088 | Soil | MGACTIGNVSEDLGPVLELNPVDAVGKRLHHDPLHERGALGHER |
| Ga0210404_108624262 | 3300021088 | Soil | MGTGAVGDVSEDLGPVLELDPVHAVGKRLHHDPLHERGALGHER |
| Ga0179585_11537661 | 3300021307 | Vadose Zone Soil | VGAGTIGDVSEDFGPVLELNPVDTIGKRLHHDPLHEWGA |
| Ga0210384_102106471 | 3300021432 | Soil | MGAGTIGNVSEDLGPVLELNPVHAVGKRLHHDPLHERGTLGHER |
| Ga0210384_105575032 | 3300021432 | Soil | MGACTIGNVSEDLRPVLELNPVDAVGKRLHHDPLHERGALGHER |
| Ga0210410_101116525 | 3300021479 | Soil | VGAGAIGHVSEDLGPVLELNPVDAVGKRLHHDPLHEWGA |
| Ga0213853_104959012 | 3300021861 | Watersheds | VSAGTIGDVSEDLCPVLELNPVDAVGKRLHDDPLHE |
| Ga0242648_10713162 | 3300022506 | Soil | MGACAIGDVSEDLCPVLELDPVDTVGKRLHHDPLHE |
| Ga0212123_10000044133 | 3300022557 | Iron-Sulfur Acid Spring | MGAGAIGDVGEDFRPVLELNPVDTVGKRLHHDPLHEWGALGHEP |
| Ga0248483_1119633 | 3300022691 | Soil | VGAGTIGDMSEDLRPVLELNPVDTVGKRLHHDPLHEWGALGHEP |
| Ga0207929_10038671 | 3300025505 | Arctic Peat Soil | DVSQDLGPVLELNPVHAVGKRLHHDPLHERRALGHER |
| Ga0207929_10085861 | 3300025505 | Arctic Peat Soil | VGACTIGDVSQDLSPVLELNPVNAVGKRFDHDPLHERGALGHER |
| Ga0209483_11942243 | 3300025862 | Arctic Peat Soil | VGACTIGDVSQDLGPVLELNPVDTVGKRLDHDPLHERGALGHER |
| Ga0207684_10000002395 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VGAGTIGHVSEDLGPVLELNPVDAVGKRLHHDPLHE |
| Ga0207646_100775256 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VGAGTIGDVSEDLRPVLELNPVDTVGKRLHHDPLHE |
| Ga0207646_100943245 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VGAGTIGDVSEDLGPVLELNPVDTVGKRLHHDPLHEWGALGHEP |
| Ga0207646_102305353 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | EEPCEVGAGTIGDVSEDLRPVLELNPVDTVGKRLHHDPLHEWGALGHER |
| Ga0207664_110466662 | 3300025929 | Agricultural Soil | MGAGAVGDVSEDLGPVLELDPVHAVGKRLHHDPLHE |
| Ga0209234_10111231 | 3300026295 | Grasslands Soil | RPVLELNPIHTIGKRLFDDPLHEWGAWGHERRVYQRPD |
| Ga0209055_10299973 | 3300026309 | Soil | MGAGAIGDVGEDLRPVLELNPVDAVGKRLHHDPLHE |
| Ga0209239_11455732 | 3300026310 | Grasslands Soil | VGAGAIGNVGQDLGPILELNPVYTVGKRLQDDPLYE |
| Ga0209471_100038913 | 3300026318 | Soil | VGAGAIGDVSEDLGPVFELNPVDAVGKRLHHDPLHE |
| Ga0209471_11187553 | 3300026318 | Soil | VGAGTIGDMSEDLGPVLELNPVDTVGKRLHHDPLHEWGALGHER |
| Ga0209131_100614911 | 3300026320 | Grasslands Soil | VGAGAIGYVGQDLGPVLELNPVYTVGKRLQDDPLDE |
| Ga0209687_10864603 | 3300026322 | Soil | VGAETIGDVGEDQRPVLELNPIHTIGKRLFDDPLHEWGAWGHERR |
| Ga0209802_100819411 | 3300026328 | Soil | VGAGAIGDVSEDLGPVLELNPVDAVGKRLHHDPLHE |
| Ga0209159_10017793 | 3300026343 | Soil | MGARAIGDVGEDLRPVLELNPVDTVGKRLHHDPLHE |
| Ga0257170_10119963 | 3300026351 | Soil | VGAGAIGNVSEDLGPVLELNPVDAVGKRLHHDPLHEWEALGHEP |
| Ga0257167_10631872 | 3300026376 | Soil | VGAGTIGDVSEDLRPVLELNPVDTVGKRLHHDPLHEWGALGQ |
| Ga0257169_10367912 | 3300026469 | Soil | GTIGDVSEDLRPVLELNPVDTVGKRLHHDPLHEWGALGHEP |
| Ga0209378_10288341 | 3300026528 | Soil | VGAETVGDVGEDQCPVLKLNPIHTVGKRLFDDPLHEWGAWGHER |
| Ga0209648_100269476 | 3300026551 | Grasslands Soil | VGAGAIGHVSEDLGPVLELNPVDAVGKRLHHDPLHEWGALGHEP |
| Ga0209213_10283373 | 3300027383 | Forest Soil | VGAGAISHVSEDLCPVLELDPVHTVGKRLHDNPFHER |
| Ga0208984_10138943 | 3300027546 | Forest Soil | MGACTIGDVSQDFRPVLELNPVYAVGERLHHDPLHD |
| Ga0209220_10128405 | 3300027587 | Forest Soil | VGACTIGDVSQDLGPVLELNPVNAVGKRLYHDPLHERGALGHER |
| Ga0209388_10240754 | 3300027655 | Vadose Zone Soil | VGAGAIGNVSEDLGPVLELNPVDAVGKRLHHDPLHE |
| Ga0209118_100222514 | 3300027674 | Forest Soil | VGACTIGNVSEDLGPVLELNPIDAVGKRLHHDPLHERGALGHER |
| Ga0209011_10772563 | 3300027678 | Forest Soil | MGACTIGDVSQDFRPVLELNPVYTVGERLHHDPLHERGALGHERRLYQKTA |
| Ga0208991_10267804 | 3300027681 | Forest Soil | MGACTIGDVSQDLSPVLELHPVHAVGKRLHDDPLHERGALGHER |
| Ga0208991_10911981 | 3300027681 | Forest Soil | MGACTIGDVSQDFRPVLELNPVYAVGERLHHDPLH |
| Ga0208991_11522992 | 3300027681 | Forest Soil | VGAGTIGDVSEDLGPVLELNPVDTIGKRLHHDPLHEWGALGHER |
| Ga0209180_100105312 | 3300027846 | Vadose Zone Soil | VGAGTIGHVSEDLGPVLELNPVDAVGKRLHHDPLHEWGALGHEP |
| Ga0209180_102245422 | 3300027846 | Vadose Zone Soil | VGAGTIGDMSEDLRPVLELNPVDTVGKRLHHDPLHEWEALGHEP |
| Ga0209180_102640223 | 3300027846 | Vadose Zone Soil | VGAGTIGHMSEDLCPVLELNPVDAVGKRLHHDPLHEWG |
| Ga0209166_100169872 | 3300027857 | Surface Soil | VGAGAIGHVSEDLGPVLELNPVYTVGKRLQHDPLHE |
| Ga0209283_100107704 | 3300027875 | Vadose Zone Soil | VGAGAIGHVSEDLGPVLELNPVDAVGKRLHHDPLHE |
| Ga0209590_100093444 | 3300027882 | Vadose Zone Soil | VGAGTIGDVSEDLRPVLELNPVDTVGKRLHHDPLHEWGALGHEP |
| Ga0209069_110079852 | 3300027915 | Watersheds | VGACTIGDVSQDFDPVLELNPVDAVGKRLHHDPLHEWGALGHER |
| Ga0137415_102532014 | 3300028536 | Vadose Zone Soil | VGAGTIGDVSEDFGPVLELNPVDTIGKRLHHDPLHEWGALGH |
| Ga0307504_100784212 | 3300028792 | Soil | VGACTIGDVSQDLGPVLELNPVYAVGKRLHDDPLHERGALGHER |
| Ga0222749_101079392 | 3300029636 | Soil | MGAGTIGNVSEDLGPVLELNPVDAVGKRLHHDPLHERGTLGHER |
| Ga0308206_11696622 | 3300030903 | Soil | VGACTIGDVSQDLGPVLELNPIYAVGKRLHHDPLH |
| Ga0318555_107654182 | 3300031640 | Soil | VTGEEPGKVGAGAVGDVSEDLGPVLELDPVHAVGKRLHHDPLHE |
| Ga0307374_1000045083 | 3300031670 | Soil | VGACTIGDVSQDLGPVLELNPVNAVGKRLDHDPLHERGALGHER |
| Ga0307477_100533611 | 3300031753 | Hardwood Forest Soil | MGAGAVGDVSEDLGPVLELDPVHAVGKRLHHDPLHERGPLGH |
| Ga0307471_1001854242 | 3300032180 | Hardwood Forest Soil | MGAGAVGDVSEDLGPVLELDPVHAVGKRLHHDPLHERGALGHERRVYQRLR |
| Ga0307471_1004148622 | 3300032180 | Hardwood Forest Soil | MGAGAVGDVSEDLGPVLELDPVYAVGKRLHHDPLHE |
| Ga0307472_1001002004 | 3300032205 | Hardwood Forest Soil | VGAGAIGNVGQDLGPVLELNPIHTVGKRLQDDPLNE |
| ⦗Top⦘ |