Scaffold draft_1002825

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold draft_1002825

Scaffold draft_1002825

Overview

Basic Information
Taxon OID	3300002853 Open in IMG/M
Scaffold ID	draft_1002825 Open in IMG/M
Source Dataset Name	PDIso9.ppmwps2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	McGill University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1773
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (25.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location
Location Name	Kootenay National Park, British Columbia
Coordinates	Lat. (^o)	51.17	Long. (^o)	-116.16	Alt. (m)		Depth (m)	.01
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082269	Metagenome / Metatranscriptome	113	Y

Sequences

Protein ID	Family	RBS	Sequence
draft_10028252	F082269	GGAGG	MDCDICGQDVENSEELQKHMEQAHPTGVGDLEKPDLVGDTPEESAASETRQATH*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.