| Basic Information | |
|---|---|
| Taxon OID | 3300002848 Open in IMG/M |
| Scaffold ID | draft_102310 Open in IMG/M |
| Source Dataset Name | PDIso5.158Aa3July202012 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | McGill University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 598671 |
| Total Scaffold Genes | 523 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 416 (79.54%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Tepid (25-34C) → Sediment → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | New Zealand | |||||||
| Coordinates | Lat. (o) | -38.358926 | Long. (o) | 176.368682 | Alt. (m) | Depth (m) | .1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F004004 | Metagenome / Metatranscriptome | 457 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| draft_102310505 | F004004 | AGGAG | MTKAKTMRMPGKERPAASRLVIQRPPTTEPHHRNLCRNTKPSAGQPIRQTAEGLDYRFLWSLPRVIGPGSLCKARPRQSDYNANTQANGLNINATHIALRTYTLTR* |
| ⦗Top⦘ |