Scaffold bg3kmer60_1108564

Overview

Basic Information

• Taxon OID: 3300002837
• Scaffold ID: bg3kmer60_1108564
• Source Dataset Name: Biogas reactor microbial communities from SLU, Sweden, that are enriched on cellulose - Sample No3 60kmer
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 516
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Biotransformation → Unclassified → Unclassified → Unclassified → Biogas Reactor → Biogas Reactor Microbial Communities From Swedish University Of Agricultural Sciences, Alnarp, Sweden, And As, Norway That Are Enriched On Cellulose

Source Dataset Sampling Location

• Location Name: Sweden: Sk?ne County
• Coordinates
  • Lat. (^o): 55.656904
  • Long. (^o): 13.082968

Associated Families

Family	Category	Number of Sequences	3D Structure?
F103495	Metagenome / Metatranscriptome	101	N

Sequences

Protein ID	Family	RBS	Sequence
bg3kmer60_11085642	F103495	GGA	MDNLLQFLIDSGLLYMIISTLLTVGIGFIVGKGVSFKEIQDIISAVEESYKDGYISPDEARKIYEEIEDVIGHDWYIRLFNFIKR*