| Basic Information | |
|---|---|
| Taxon OID | 3300002835 Open in IMG/M |
| Scaffold ID | B570J40625_100909442 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 761 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Mendota, Madison, Wisconsin, USA | |||||||
| Coordinates | Lat. (o) | 43.099444 | Long. (o) | -89.404444 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F042355 | Metagenome / Metatranscriptome | 158 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| B570J40625_1009094421 | F042355 | N/A | MSTELKQINKLKKTARRNDNVNDNKFIERLIKISRVTKVTKGGKKLS |
| ⦗Top⦘ |