Basic Information | |
---|---|
Family ID | F042355 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 158 |
Average Sequence Length | 43 residues |
Representative Sequence | MSTDLKQVNKLKKNSRRNDNRNEPKFVERLIKISRVSKVTKGG |
Number of Associated Samples | 139 |
Number of Associated Scaffolds | 158 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 13.92 % |
% of genes near scaffold ends (potentially truncated) | 86.71 % |
% of genes from short scaffolds (< 2000 bps) | 77.85 % |
Associated GOLD sequencing projects | 135 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.37 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (56.329 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine (21.519 % of family members) |
Environment Ontology (ENVO) | Unclassified (37.975 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (72.152 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.44% β-sheet: 0.00% Coil/Unstructured: 60.56% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 158 Family Scaffolds |
---|---|---|
PF00861 | Ribosomal_L18p | 56.33 |
PF00347 | Ribosomal_L6 | 18.99 |
PF00410 | Ribosomal_S8 | 6.96 |
PF00673 | Ribosomal_L5_C | 5.06 |
PF00238 | Ribosomal_L14 | 3.16 |
PF17136 | ribosomal_L24 | 1.90 |
PF00344 | SecY | 1.90 |
PF00333 | Ribosomal_S5 | 1.27 |
PF01578 | Cytochrom_C_asm | 0.63 |
PF03719 | Ribosomal_S5_C | 0.63 |
PF03947 | Ribosomal_L2_C | 0.63 |
PF00572 | Ribosomal_L13 | 0.63 |
PF00203 | Ribosomal_S19 | 0.63 |
PF07650 | KH_2 | 0.63 |
COG ID | Name | Functional Category | % Frequency in 158 Family Scaffolds |
---|---|---|---|
COG0256 | Ribosomal protein L18 | Translation, ribosomal structure and biogenesis [J] | 56.33 |
COG0097 | Ribosomal protein L6P/L9E | Translation, ribosomal structure and biogenesis [J] | 18.99 |
COG0096 | Ribosomal protein S8 | Translation, ribosomal structure and biogenesis [J] | 6.96 |
COG0094 | Ribosomal protein L5 | Translation, ribosomal structure and biogenesis [J] | 5.06 |
COG0093 | Ribosomal protein L14 | Translation, ribosomal structure and biogenesis [J] | 3.16 |
COG0098 | Ribosomal protein S5 | Translation, ribosomal structure and biogenesis [J] | 1.90 |
COG0201 | Preprotein translocase subunit SecY | Intracellular trafficking, secretion, and vesicular transport [U] | 1.90 |
COG0090 | Ribosomal protein L2 | Translation, ribosomal structure and biogenesis [J] | 0.63 |
COG0102 | Ribosomal protein L13 | Translation, ribosomal structure and biogenesis [J] | 0.63 |
COG0185 | Ribosomal protein S19 | Translation, ribosomal structure and biogenesis [J] | 0.63 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 56.33 % |
Unclassified | root | N/A | 43.67 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000944|BBAY81_10063943 | Not Available | 632 | Open in IMG/M |
3300002372|B570J29634_100545 | Not Available | 1652 | Open in IMG/M |
3300002835|B570J40625_100909442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 761 | Open in IMG/M |
3300003265|JGI26118J46590_1009477 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
3300003621|JGI26083J51738_10065113 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
3300004011|Ga0055460_10271565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales | 544 | Open in IMG/M |
3300005824|Ga0074474_1408015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 35140 | Open in IMG/M |
3300005825|Ga0074476_1247737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 5702 | Open in IMG/M |
3300005828|Ga0074475_10533089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 15842 | Open in IMG/M |
3300005836|Ga0074470_10189775 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
3300005988|Ga0075160_10707342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 535 | Open in IMG/M |
3300006056|Ga0075163_11399914 | Not Available | 686 | Open in IMG/M |
3300006373|Ga0075483_1207227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1311 | Open in IMG/M |
3300006393|Ga0075517_1524337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1620 | Open in IMG/M |
3300006394|Ga0075492_1532996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2571 | Open in IMG/M |
3300006397|Ga0075488_1563361 | Not Available | 648 | Open in IMG/M |
3300006399|Ga0075495_1535365 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300006400|Ga0075503_1031691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 4516 | Open in IMG/M |
3300006868|Ga0075481_10300144 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300006869|Ga0075477_10190906 | Not Available | 842 | Open in IMG/M |
3300007217|Ga0079268_1315763 | Not Available | 552 | Open in IMG/M |
3300007242|Ga0075172_1574303 | Not Available | 1222 | Open in IMG/M |
3300007250|Ga0075165_1041389 | Not Available | 579 | Open in IMG/M |
3300007250|Ga0075165_1084468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2972 | Open in IMG/M |
3300007551|Ga0102881_1026515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1631 | Open in IMG/M |
3300007551|Ga0102881_1208896 | Not Available | 540 | Open in IMG/M |
3300007614|Ga0102946_1388401 | Not Available | 530 | Open in IMG/M |
3300007629|Ga0102895_1018736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1723 | Open in IMG/M |
3300007981|Ga0102904_1011549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1928 | Open in IMG/M |
3300007981|Ga0102904_1023324 | Not Available | 1378 | Open in IMG/M |
3300007981|Ga0102904_1126282 | Not Available | 602 | Open in IMG/M |
3300007986|Ga0100380_10282916 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
3300008095|Ga0100392_1254167 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
3300008106|Ga0114339_1033717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2810 | Open in IMG/M |
3300008264|Ga0114353_1003918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 10258 | Open in IMG/M |
3300008929|Ga0103732_1021677 | Not Available | 923 | Open in IMG/M |
3300008931|Ga0103734_1010935 | Not Available | 1230 | Open in IMG/M |
3300009026|Ga0102829_1077788 | Not Available | 1018 | Open in IMG/M |
3300009080|Ga0102815_10212187 | Not Available | 1065 | Open in IMG/M |
3300009080|Ga0102815_10917418 | Not Available | 502 | Open in IMG/M |
3300009141|Ga0102884_1108477 | Not Available | 699 | Open in IMG/M |
3300009327|Ga0103843_102554 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
3300009422|Ga0114998_10108622 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
3300009432|Ga0115005_10077081 | All Organisms → cellular organisms → Bacteria | 2553 | Open in IMG/M |
3300009436|Ga0115008_10644124 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
3300009515|Ga0129286_10190266 | Not Available | 686 | Open in IMG/M |
3300009543|Ga0115099_10660583 | Not Available | 1193 | Open in IMG/M |
3300009592|Ga0115101_1690705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 3942 | Open in IMG/M |
3300009606|Ga0115102_10920652 | Not Available | 851 | Open in IMG/M |
3300009608|Ga0115100_10464832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1982 | Open in IMG/M |
3300009608|Ga0115100_10612678 | Not Available | 546 | Open in IMG/M |
3300009677|Ga0115104_10184917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 14852 | Open in IMG/M |
3300009728|Ga0123371_128878 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
3300009787|Ga0116226_11855085 | Not Available | 549 | Open in IMG/M |
3300010370|Ga0129336_10088527 | Not Available | 1822 | Open in IMG/M |
3300011012|Ga0150979_1463343 | Not Available | 956 | Open in IMG/M |
3300012408|Ga0138265_1259339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales | 3807 | Open in IMG/M |
3300012408|Ga0138265_1314007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 7921 | Open in IMG/M |
3300012408|Ga0138265_1447673 | Not Available | 501 | Open in IMG/M |
3300012418|Ga0138261_1257929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 7534 | Open in IMG/M |
3300012518|Ga0129349_1165542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1190 | Open in IMG/M |
3300012524|Ga0129331_1465546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae | 3957 | Open in IMG/M |
3300012782|Ga0138268_1588910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 7604 | Open in IMG/M |
3300012928|Ga0163110_10809388 | Not Available | 737 | Open in IMG/M |
3300012954|Ga0163111_10439958 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
3300012965|Ga0129346_1032754 | All Organisms → cellular organisms → Bacteria | 1929 | Open in IMG/M |
3300017764|Ga0181385_1198369 | Not Available | 606 | Open in IMG/M |
3300018605|Ga0193339_1002109 | All Organisms → cellular organisms → Bacteria | 1476 | Open in IMG/M |
3300018635|Ga0193376_1001105 | Not Available | 1637 | Open in IMG/M |
3300018723|Ga0193038_1061680 | Not Available | 576 | Open in IMG/M |
3300018930|Ga0192955_10012920 | Not Available | 1443 | Open in IMG/M |
3300018930|Ga0192955_10021880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales | 1244 | Open in IMG/M |
3300018930|Ga0192955_10058242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 900 | Open in IMG/M |
3300018930|Ga0192955_10183225 | Not Available | 540 | Open in IMG/M |
3300018942|Ga0193426_10000155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 4367 | Open in IMG/M |
3300019009|Ga0192880_10000490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 4216 | Open in IMG/M |
3300019010|Ga0193044_10024324 | Not Available | 1815 | Open in IMG/M |
3300019010|Ga0193044_10064060 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
3300019021|Ga0192982_10001590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2954 | Open in IMG/M |
3300019021|Ga0192982_10040705 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
3300019022|Ga0192951_10019828 | All Organisms → cellular organisms → Bacteria | 1502 | Open in IMG/M |
3300019036|Ga0192945_10270841 | Not Available | 534 | Open in IMG/M |
3300019037|Ga0192886_10084570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 904 | Open in IMG/M |
3300019049|Ga0193082_10005811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2021 | Open in IMG/M |
3300019050|Ga0192966_10056941 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
3300019053|Ga0193356_10294399 | Not Available | 571 | Open in IMG/M |
3300019103|Ga0192946_1002222 | All Organisms → cellular organisms → Bacteria | 2027 | Open in IMG/M |
3300019125|Ga0193104_1002441 | All Organisms → cellular organisms → Bacteria | 1690 | Open in IMG/M |
3300019701|Ga0194015_1010463 | Not Available | 917 | Open in IMG/M |
3300019703|Ga0194021_1035025 | Not Available | 568 | Open in IMG/M |
3300019719|Ga0193977_1034144 | Not Available | 631 | Open in IMG/M |
3300019737|Ga0193973_1027810 | Not Available | 681 | Open in IMG/M |
3300019749|Ga0193983_1064695 | Not Available | 567 | Open in IMG/M |
3300020084|Ga0194110_10764238 | Not Available | 590 | Open in IMG/M |
3300020162|Ga0211735_10429820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 32059 | Open in IMG/M |
3300021169|Ga0206687_1086693 | Not Available | 588 | Open in IMG/M |
3300021169|Ga0206687_1191956 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
3300021169|Ga0206687_1897978 | Not Available | 595 | Open in IMG/M |
3300021266|Ga0210348_150286 | All Organisms → cellular organisms → Bacteria | 2342 | Open in IMG/M |
3300021267|Ga0210353_125427 | All Organisms → cellular organisms → Bacteria | 2848 | Open in IMG/M |
3300021273|Ga0210340_1050216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2402 | Open in IMG/M |
3300021275|Ga0210342_147795 | Not Available | 573 | Open in IMG/M |
3300021278|Ga0210332_131606 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
3300021282|Ga0210303_1033778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales | 3271 | Open in IMG/M |
3300021282|Ga0210303_1063427 | Not Available | 916 | Open in IMG/M |
3300021293|Ga0210358_178454 | Not Available | 645 | Open in IMG/M |
3300021298|Ga0210349_1143755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2838 | Open in IMG/M |
3300021305|Ga0210296_1076650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 8714 | Open in IMG/M |
3300021317|Ga0210309_1050518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 4561 | Open in IMG/M |
3300021329|Ga0210362_1353221 | Not Available | 871 | Open in IMG/M |
3300021356|Ga0213858_10200699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 968 | Open in IMG/M |
3300021364|Ga0213859_10040178 | All Organisms → cellular organisms → Bacteria | 2220 | Open in IMG/M |
3300021379|Ga0213864_10039745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2223 | Open in IMG/M |
3300022171|Ga0213857_1013719 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
3300022220|Ga0224513_10326713 | Not Available | 613 | Open in IMG/M |
3300022366|Ga0210344_100597 | All Organisms → cellular organisms → Bacteria | 2030 | Open in IMG/M |
3300022372|Ga0210293_114423 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
3300022389|Ga0210318_1158020 | Not Available | 509 | Open in IMG/M |
3300024262|Ga0210003_1246127 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
3300024346|Ga0244775_11556031 | Not Available | 504 | Open in IMG/M |
3300024348|Ga0244776_10963826 | Not Available | 500 | Open in IMG/M |
3300024532|Ga0256352_1007508 | All Organisms → cellular organisms → Bacteria | 1862 | Open in IMG/M |
3300024534|Ga0256357_1062608 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
3300025035|Ga0210011_1045993 | All Organisms → cellular organisms → Bacteria | 2277 | Open in IMG/M |
3300025632|Ga0209194_1116317 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300025751|Ga0208150_1197299 | Not Available | 622 | Open in IMG/M |
3300025832|Ga0209307_1038918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1808 | Open in IMG/M |
3300025879|Ga0209555_10187712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 839 | Open in IMG/M |
3300025896|Ga0208916_10275017 | Not Available | 732 | Open in IMG/M |
3300025997|Ga0210013_1054646 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
3300026131|Ga0209928_1036776 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
3300026138|Ga0209951_1102488 | Not Available | 587 | Open in IMG/M |
3300027186|Ga0208797_1043118 | Not Available | 575 | Open in IMG/M |
3300027195|Ga0208676_1013313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 760 | Open in IMG/M |
3300027204|Ga0208924_108180 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
3300027212|Ga0208554_1050941 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300027230|Ga0208171_1015706 | Not Available | 756 | Open in IMG/M |
3300027243|Ga0208174_1002976 | All Organisms → cellular organisms → Bacteria | 2073 | Open in IMG/M |
3300027243|Ga0208174_1033160 | Not Available | 652 | Open in IMG/M |
3300027320|Ga0208923_1092060 | Not Available | 536 | Open in IMG/M |
3300027526|Ga0209968_1097012 | Not Available | 536 | Open in IMG/M |
3300027553|Ga0208947_1120059 | Not Available | 583 | Open in IMG/M |
3300027673|Ga0209278_1247254 | Not Available | 514 | Open in IMG/M |
3300027813|Ga0209090_10335080 | Not Available | 742 | Open in IMG/M |
(restricted) 3300027837|Ga0255041_10409255 | Not Available | 500 | Open in IMG/M |
3300027849|Ga0209712_10205926 | Not Available | 1120 | Open in IMG/M |
3300027849|Ga0209712_10820494 | Not Available | 507 | Open in IMG/M |
3300027906|Ga0209404_10061114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2153 | Open in IMG/M |
3300029998|Ga0302271_10202214 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
3300030294|Ga0311349_11989222 | Not Available | 535 | Open in IMG/M |
3300031223|Ga0307981_1110370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 784 | Open in IMG/M |
3300031716|Ga0310813_10483680 | Not Available | 1079 | Open in IMG/M |
3300032231|Ga0316187_11122506 | Not Available | 575 | Open in IMG/M |
3300032263|Ga0316195_10207541 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
3300032272|Ga0316189_10209773 | All Organisms → cellular organisms → Bacteria | 1538 | Open in IMG/M |
3300032272|Ga0316189_10782661 | Not Available | 726 | Open in IMG/M |
3300032373|Ga0316204_10677964 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
3300033524|Ga0316592_1011196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1819 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 21.52% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 17.09% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 8.23% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 5.70% |
Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 3.80% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 3.16% |
Polar Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine | 3.16% |
Aquifer | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Aquifer | 2.53% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 2.53% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 2.53% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.90% |
Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 1.90% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.90% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.27% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.27% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.27% |
Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.27% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.27% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.27% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.27% |
Ice Edge, Mcmurdo Sound, Antarctica | Environmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica | 1.27% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.63% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.63% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.63% |
River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.63% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.63% |
Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Sediment | 0.63% |
Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.63% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.63% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.63% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.63% |
Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Marine | 0.63% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.63% |
Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.63% |
Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.63% |
Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.63% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.63% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.63% |
Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.63% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.63% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.63% |
Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.63% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000944 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY81 | Host-Associated | Open in IMG/M |
3300002372 | Freshwater microbial communities from Lake Mendota, WI - 27SEP2012 deep hole epilimnion | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003265 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_66_BLW_10 | Environmental | Open in IMG/M |
3300003621 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA | Environmental | Open in IMG/M |
3300004011 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2 | Environmental | Open in IMG/M |
3300005824 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.180_BBC | Environmental | Open in IMG/M |
3300005825 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.184_BBB | Environmental | Open in IMG/M |
3300005828 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.182_BBI | Environmental | Open in IMG/M |
3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
3300005988 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNA | Engineered | Open in IMG/M |
3300006056 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 1A DNA | Engineered | Open in IMG/M |
3300006373 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006393 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006394 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006397 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006399 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006400 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
3300007217 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S10 NT17 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300007242 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 C RNA (Eukaryote Community Metatranscriptome) | Engineered | Open in IMG/M |
3300007250 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 6/11/14 B RNA (Eukaryote Community Metatranscriptome) | Engineered | Open in IMG/M |
3300007551 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3 | Environmental | Open in IMG/M |
3300007614 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_D1_MG | Environmental | Open in IMG/M |
3300007629 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-3 | Environmental | Open in IMG/M |
3300007981 | Estuarine microbial communities from the Columbia River estuary - metaG 1556A-3 | Environmental | Open in IMG/M |
3300007986 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-04 | Environmental | Open in IMG/M |
3300008095 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-16 | Environmental | Open in IMG/M |
3300008106 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-53-LTR | Environmental | Open in IMG/M |
3300008264 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTR | Environmental | Open in IMG/M |
3300008929 | Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1A | Environmental | Open in IMG/M |
3300008931 | Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1C | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009080 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 | Environmental | Open in IMG/M |
3300009141 | Estuarine microbial communities from the Columbia River estuary - metaG 1550A-3 | Environmental | Open in IMG/M |
3300009327 | Microbial communities of water from the North Atlantic ocean - ACM30 | Environmental | Open in IMG/M |
3300009422 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 | Environmental | Open in IMG/M |
3300009432 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome | Environmental | Open in IMG/M |
3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
3300009515 | Microbial community of beach aquifer sediment core from Cape Shores, Lewes, Delaware, USA - CF-2 | Environmental | Open in IMG/M |
3300009543 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009592 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009606 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009608 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009677 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009728 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_213_2m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009787 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fa - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300011012 | Marine surface microbial communities from Baltic Sea. Combined Assembly of 24 SPs | Environmental | Open in IMG/M |
3300012408 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012418 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA12.A_72.20151113 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012518 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012524 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012782 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
3300012965 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
3300018605 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001754 (ERX1782444-ERR1712177) | Environmental | Open in IMG/M |
3300018635 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_122 - TARA_N000001943 (ERX1782126-ERR1712207) | Environmental | Open in IMG/M |
3300018723 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000268 (ERX1782137-ERR1712170) | Environmental | Open in IMG/M |
3300018930 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001396 (ERX1782254-ERR1712008) | Environmental | Open in IMG/M |
3300018942 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002295 (ERX1782357-ERR1712003) | Environmental | Open in IMG/M |
3300019009 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000756 (ERX1782233-ERR1711966) | Environmental | Open in IMG/M |
3300019010 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838) | Environmental | Open in IMG/M |
3300019021 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957) | Environmental | Open in IMG/M |
3300019022 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194) | Environmental | Open in IMG/M |
3300019036 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086) | Environmental | Open in IMG/M |
3300019037 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782146-ERR1712183) | Environmental | Open in IMG/M |
3300019049 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782179-ERR1712232) | Environmental | Open in IMG/M |
3300019050 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865) | Environmental | Open in IMG/M |
3300019053 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001823 (ERX1782123-ERR1712241) | Environmental | Open in IMG/M |
3300019103 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021) | Environmental | Open in IMG/M |
3300019125 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002761 (ERX1782425-ERR1712222) | Environmental | Open in IMG/M |
3300019701 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_1-2_MG | Environmental | Open in IMG/M |
3300019703 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_7-8_MG | Environmental | Open in IMG/M |
3300019719 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRT_4-5_MG | Environmental | Open in IMG/M |
3300019737 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_9-10_MG | Environmental | Open in IMG/M |
3300019749 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLT_4-5_MG | Environmental | Open in IMG/M |
3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
3300021169 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021266 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.458 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021267 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.489 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021273 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.386 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021275 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.429 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021278 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.302 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021282 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1035 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021293 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.589 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021298 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.460 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021305 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R868 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021317 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1088 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021329 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.625 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
3300021379 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247 | Environmental | Open in IMG/M |
3300022171 | Metatranscriptome of freshwater sediment microbial communities from pre-fracked creek in Pennsylvania, United States - G-2016_45 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022220 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_21 | Environmental | Open in IMG/M |
3300022366 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.437 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022372 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R8.46A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022389 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.24 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
3300024532 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024534 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025035 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-02 (SPAdes) | Environmental | Open in IMG/M |
3300025632 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes) | Environmental | Open in IMG/M |
3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025832 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 (SPAdes) | Environmental | Open in IMG/M |
3300025879 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025997 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-06 (SPAdes) | Environmental | Open in IMG/M |
3300026131 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D2_MG (SPAdes) | Environmental | Open in IMG/M |
3300026138 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
3300027186 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 (SPAdes) | Environmental | Open in IMG/M |
3300027195 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-3 (SPAdes) | Environmental | Open in IMG/M |
3300027204 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-3 (SPAdes) | Environmental | Open in IMG/M |
3300027212 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 (SPAdes) | Environmental | Open in IMG/M |
3300027230 | Estuarine microbial communities from the Columbia River estuary - metaG 1551A-3 (SPAdes) | Environmental | Open in IMG/M |
3300027243 | Estuarine microbial communities from the Columbia River estuary - metaG 1556A-3 (SPAdes) | Environmental | Open in IMG/M |
3300027320 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes) | Environmental | Open in IMG/M |
3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027553 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_04_M0_20 (SPAdes) | Environmental | Open in IMG/M |
3300027673 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 B green DNA (SPAdes) | Engineered | Open in IMG/M |
3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
3300027837 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_3 | Environmental | Open in IMG/M |
3300027849 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes) | Environmental | Open in IMG/M |
3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
3300029998 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_1 | Environmental | Open in IMG/M |
3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300031223 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #987 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300032231 | Coastal sediment microbial communities from Maine, United States - Cross River worm burrow 1 | Environmental | Open in IMG/M |
3300032263 | Coastal sediment microbial communities from Maine, United States - Phippsburg sediment 1 | Environmental | Open in IMG/M |
3300032272 | Coastal sediment microbial communities from Maine, United States - Lowes Cove worm burrow | Environmental | Open in IMG/M |
3300032373 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2 | Environmental | Open in IMG/M |
3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
BBAY81_100639432 | 3300000944 | Macroalgal Surface | MSSDLKQLNKIKKNSRRTNTVQKPRLVERLIKISRVSKVTK |
B570J29634_1005454 | 3300002372 | Freshwater | MSTELKQVNKLKKTARRNDNLNDNKFIERLIKISRVTKVT |
B570J40625_1009094421 | 3300002835 | Freshwater | MSTELKQINKLKKTARRNDNVNDNKFIERLIKISRVTKVTKGGKKLS |
JGI26118J46590_10094771 | 3300003265 | Marine | MSTELKQVNKLKKTPRRNENQNDKFIERLIKISRVTKVTKGG |
JGI26083J51738_100651131 | 3300003621 | Marine | MSSELKQVNKLKKTPRRNDNRNDDKFIERLIKIGRVTKVTKGGKKLSF |
Ga0055460_102715652 | 3300004011 | Natural And Restored Wetlands | MSTDFKQVNKSKKTLQRSDILTESKLVERLIKISRVSKVTKGGKKLSFRA |
Ga0074474_14080151 | 3300005824 | Sediment (Intertidal) | MNSDLKKVNKLKRNSRPNNNAIEAKFVERLIKISRVSKVTKGG |
Ga0074476_12477371 | 3300005825 | Sediment (Intertidal) | MSIDLKQVNKVKKNFRRSEPMNEPKFIERLIKISRVSKVTK |
Ga0074475_1053308926 | 3300005828 | Sediment (Intertidal) | MSNDLKQQNKVKKNSRRTNNLQEPKFVERLIKISRVSKVTK |
Ga0074470_101897751 | 3300005836 | Sediment (Intertidal) | MSSDLKKINRKNYRPTLNLQEPKFVERLIKISRVSKVTKGGKKLS |
Ga0075160_107073421 | 3300005988 | Wastewater Effluent | MSSDLKKINKLKPNSRRKQNIQEPKLVERLIKISRVSKVTKGGKKLSFRA |
Ga0075163_113999141 | 3300006056 | Wastewater Effluent | MSSDLKQLNKLKKNSRRNNQPQEPKFVERLIKISRVSKVTKGGKKLS |
Ga0075483_12072274 | 3300006373 | Aqueous | MSTDLKQVNKFKKNPRRNQKSFEKPLVERLIQISRVSKVTKG |
Ga0075517_15243371 | 3300006393 | Aqueous | MSTDLKQVNKSKKNSKRGDNSNEPKLVERLIKIGRVSKV |
Ga0075492_15329966 | 3300006394 | Aqueous | MSTELKQVNKLKKTSRRNDNLNDAKFIERLIKISRVTKVTKGGKKLS |
Ga0075488_15633612 | 3300006397 | Aqueous | MSTDLKQVNKSKKNSQRNDSESKLAERLIKISRVSK |
Ga0075495_15353652 | 3300006399 | Aqueous | MSTELKQVNKLKKTPRRNDNRNDDKFIERLIKIGRVTKVTKGGKKIKFSCCCCNWR* |
Ga0075503_10316918 | 3300006400 | Aqueous | MSTDLKQLNKGRKNARRNNASQEPKLVERLIKISRVSKVTKGGKKIKFPSSCCSW* |
Ga0075481_103001442 | 3300006868 | Aqueous | MSTNLKQANKKTKNSRRNENFNEPKFIERLIKISRVSKVTKGGKKLSF |
Ga0075477_101909061 | 3300006869 | Aqueous | MSTNLKQANKKTKNSRRNENFNEPKFIERLIKISRVS |
Ga0079268_13157632 | 3300007217 | Marine | MSSDLKKINKKNSGRKSNSQELKLVERLIKISRVSKVTKGG |
Ga0075172_15743033 | 3300007242 | Wastewater Effluent | MSSDLKQLNKLKKNSRRNNQLQEPKFVERLIKISRVSKVTK |
Ga0075165_10413892 | 3300007250 | Wastewater Effluent | MSSDLKQLNKLKKNSRRNNQLQEPKFVERLIKISR |
Ga0075165_10844681 | 3300007250 | Wastewater Effluent | MSSDLKQLNKLKKNSRRNNQLQEPKFVERLIKISRVSKVTKGGKK |
Ga0102881_10265154 | 3300007551 | Estuarine | MSTELKQVNKLKKTPRRNGNQNDDKFVERLIKISRVTKV |
Ga0102881_12088961 | 3300007551 | Estuarine | MSTELKQVNKLKKTSRRNENINDAKFVERLIKISRVTKVTKG |
Ga0102946_13884012 | 3300007614 | Soil | MSSDLKKINKLKKNSRRNTNIQEPKFVERLIKISRV |
Ga0102895_10187364 | 3300007629 | Estuarine | MSTELKQVNKLKKTARRNDNVNDNKFIERLIKISRVTKVTKGGKKLSFVR* |
Ga0102904_10115491 | 3300007981 | Estuarine | MSTDLKQVNKVKKNPRRNERINEPRFVERLIKIGRVSKVTKGGKKL |
Ga0102904_10233244 | 3300007981 | Estuarine | MSTDLKQVNKLKKNPRRNEISNESKFVERLIKISRVSKVTKGGK |
Ga0102904_11262822 | 3300007981 | Estuarine | MSDSSTDLRKQRRAKQNSRRQPKFVERLIKISRVSKVTKGGKKLSF |
Ga0100380_102829163 | 3300007986 | Aquifer | MTSDLKKINKKSNSRRKQNIQESKLVERLIKISRVSKVTK |
Ga0100392_12541673 | 3300008095 | Aquifer | MTSDLKKINKKSNSRRKQNIQESKLVERLIKISRVSKVTKGR* |
Ga0114339_10337171 | 3300008106 | Freshwater, Plankton | MSSDLKKINKKNSRRNPNIQEPKFVERLIKISRVSKVTK |
Ga0114353_100391820 | 3300008264 | Freshwater, Plankton | MSSDLKKINKKNSRRNPNTQEPKFVERLIKISRVSKVTKGG |
Ga0103732_10216773 | 3300008929 | Ice Edge, Mcmurdo Sound, Antarctica | MNTDLKRSNKGKKNTRRNEVRFTERLIKISRVSKVTKGGKKLS |
Ga0103734_10109351 | 3300008931 | Ice Edge, Mcmurdo Sound, Antarctica | MSTNLQQLNKLKKNPRRKEKINEPKFVERLIKISRVSKVTKGGKKLSF |
Ga0102829_10777883 | 3300009026 | Estuarine | MSTDLKQINKAKKNLRRTDTVNEPKFVERLIKISRVSKVTK |
Ga0102815_102121871 | 3300009080 | Estuarine | MSTDLKQVNKSKRNSQRNDKSNELKLVERLIKIGRVSKVTKGGKKL |
Ga0102815_109174181 | 3300009080 | Estuarine | MNTDLKQVNKLKKTGRRPVRNQQPQLVERLIKISRVSKVTKGGKKLSFRA |
Ga0102884_11084773 | 3300009141 | Estuarine | MSTDLKKQGRVKRNARRQPQFVERLIKISRVSKVTKGGKKL |
Ga0103843_1025541 | 3300009327 | River Water | MSTDLKQVNKFKKNTRRVDTRNEPKFVERLIKISRVSKVTKG* |
Ga0114998_101086224 | 3300009422 | Marine | MSTDLKQVNKSKKNSRRTDDRNEQKFVERLIKISRV |
Ga0115005_100770816 | 3300009432 | Marine | MNTDLKQVNKAKKNVRRNDKRTEVKFAERLIKISRVSKVTKGGK |
Ga0115008_106441241 | 3300009436 | Marine | MSTDLKKVNKQNTRRNDNDPKFVERLIKISRVSKVTKGGKKLSFR |
Ga0129286_101902661 | 3300009515 | Sediment | MNSDLKKINKARKNSRSNANVNKSRFVERLIKINRVSKVTKGGKKLSF |
Ga0115099_106605833 | 3300009543 | Marine | MNTDLQQVNKVKKKSRRNENRNETKFSERLIKISRVSKVTKG |
Ga0115101_16907051 | 3300009592 | Marine | MSTELKQVNKLKKTQRRNEHGNDAKFIERLIKISRVTKVTKGGKKMSFR |
Ga0115102_109206521 | 3300009606 | Marine | MSNDLKKINKKRNSRRNTNIQEPKFVERLIKISRVSKVTKGGKKLSF |
Ga0115100_104648322 | 3300009608 | Marine | MSTNLKQANKLKKNSRRNDNRNEPKFVERLIKISRVSKVTKGGKN* |
Ga0115100_106126781 | 3300009608 | Marine | MSSDLKQLNKFKKNSRRTNNIREPKLVERLIKISRVSKVTKG |
Ga0115104_1018491714 | 3300009677 | Marine | MSTDLKEVNKGKKAPRRNNRPREKQLVERLVQISRVSK* |
Ga0123371_1288783 | 3300009728 | Marine | MSTDPKQVNKIKKNSRRVENNTEPKFIERLIKISRVSKVTKGGKK |
Ga0116226_118550851 | 3300009787 | Host-Associated | MSNDLKKINKLKKNSRRTNNVPESKFVERLIKISRVSKVTK |
Ga0129336_100885273 | 3300010370 | Freshwater To Marine Saline Gradient | MNNLKIRNSMSTDLKQVNKLRKTPRRTENQNDAKFFERLIKISRVTKVTKGGKK* |
Ga0150979_14633431 | 3300011012 | Marine | MSTDLREANKAKKNPRRNNPLPKSKFVERLIKISRVSKVTKGGKKL |
Ga0138265_12593393 | 3300012408 | Polar Marine | MSTELKQVNKLKKTSRRNESLHDTKFVERLIKISRVTKVTKGGKK* |
Ga0138265_131400714 | 3300012408 | Polar Marine | MSTELKQVNKLKKTSRRKENPNDIKFVERLIKISRVTKVTKGGKKLKFSRRCCYR* |
Ga0138265_14476732 | 3300012408 | Polar Marine | MSTDLKRVKKNSRNKPKFVERLIKISRVSKVTKGGK |
Ga0138261_125792920 | 3300012418 | Polar Marine | MSTDLKEVNKGKKNPRRNTRPREKQLVERLVQISRVSKVTKGGKK |
Ga0129349_11655421 | 3300012518 | Aqueous | MSTDLKQVNKSKRNSQRNDNSNEFRLVERLIKIGRVSKVTKGGKKLSF |
Ga0129331_146554610 | 3300012524 | Aqueous | MSTDLKQVNKLKKNPRRNEKNNEPRFVERLIKIGR |
Ga0138268_158891017 | 3300012782 | Polar Marine | MSSNIKKINKKNSRPSAQEPMFVERLIKISRVSKVTKG |
Ga0163110_108093882 | 3300012928 | Surface Seawater | MSNNLKKINKKNSWRNRTVQEPKLTERLIKISRVSKVTKGGKKLSFR |
Ga0163111_104399581 | 3300012954 | Surface Seawater | MANELKEVNKNKKNGRRSYKSNEPKFLERLIKISRVSKVTKG |
Ga0129346_10327541 | 3300012965 | Aqueous | MNTDLKQVNKLKKNSRRNDTKNDQKFVERLIKISRVCKVTKGGKKLSF |
Ga0181385_11983692 | 3300017764 | Seawater | MSTELKQVNKLKKTSRRNENINDAKFVERLIKISRVTKVTKGGKKL |
Ga0193339_10021091 | 3300018605 | Marine | MSTDLKKISRVKKNSRNKPKLVERLIKISRVSKVT |
Ga0193376_10011054 | 3300018635 | Marine | MSTKLKQVNKLKKIQRSNEHGNNTKFIERLIKISRVTKVTKGGKKMS |
Ga0193038_10616802 | 3300018723 | Marine | MSTDLKQANKPKKNSRRNENFNEPKFIERLIKISRVSKVTKGG |
Ga0192955_100129201 | 3300018930 | Marine | MSNDLKEVNKLKKNSRRLENTNEPKFVERLIKISRVSKVTKGGKKLSFRSI |
Ga0192955_100218801 | 3300018930 | Marine | MSTDLKRVKKNSRNKPKFVERLIKISRVSKVTKGGKKL |
Ga0192955_100582423 | 3300018930 | Marine | MSTNLKQLNKPKKHDQFNESSNKPELVERLIKISRVSKVTKGGKKLSFR |
Ga0192955_101832252 | 3300018930 | Marine | MSTELKQVNKLKKTFRRNENLNDNKFIERLIKISRVTKVTKGGK |
Ga0193426_1000015511 | 3300018942 | Marine | MSTELKQVNKLKKTSRRNENLNDNKFIERLIKISRVTKV |
Ga0192880_100004905 | 3300019009 | Marine | MSTDLKKISRVKKNSRNKPKFVERLIKISRVSKVTKGGKKIKFPCNCCYW |
Ga0193044_100243245 | 3300019010 | Marine | MSTDLKKVNKKNTRRNDNNSKFVERLIKISRVSKVT |
Ga0193044_100640601 | 3300019010 | Marine | MSTNLKQLNKPKKHDQFNKLSNKPELVERLIKISRVSKVTKG |
Ga0192982_100015907 | 3300019021 | Marine | MSTELKRVNKLKKTSRRNGNLHDPKFVERLIKISRVTKVTKGRKKMSFRAVV |
Ga0192982_100407051 | 3300019021 | Marine | MSNNLKKINKKNSWRNRAVQEPKLTERLIKISRVSKVTKGG |
Ga0192951_100198284 | 3300019022 | Marine | MNTDSKRINKGKKNARRNEVRFTERLIKISRVSKVTKGGK |
Ga0192945_102708412 | 3300019036 | Marine | MSTDLKKISRVKKNSRNKPKFVERLIKISRVSKVTK |
Ga0192886_100845701 | 3300019037 | Marine | MSTNLKQLNKPKKHDQFNKLSNKPELVERLIKISRVSKVT |
Ga0193082_100058115 | 3300019049 | Marine | MSTSLKQVNKQKKSLRRNDNRNEQKFVERLIKISRVSKVTKK |
Ga0192966_100569411 | 3300019050 | Marine | MTNDLKKINKKRSSRRNLSSYEPKLVERLIKISRVS |
Ga0193356_102943991 | 3300019053 | Marine | MSSTLKKANKFKKNSRRVANLQEPKLVERLIKISRVSKVTKGG |
Ga0192946_10022221 | 3300019103 | Marine | MSTDLKKISRVKKNSRNKPKFAERLIKISRVSKVTKGGKKLSFR |
Ga0193104_10024411 | 3300019125 | Marine | MASDLKKINKLRKNSRRLNNIQEPKLVERLIKISRVSKVTKGGKKL |
Ga0194015_10104633 | 3300019701 | Sediment | MSTELKQINKLKKSRRNENLNDAKFIERLIKISRVTKVTK |
Ga0194021_10350252 | 3300019703 | Sediment | MSTELKQVNKLKKTPRRNENQNDKFIERLIKISRVTKVT |
Ga0193977_10341441 | 3300019719 | Sediment | MSAELKQVNKLKKTSRRNENLNDTKFIERLIKISRVTKVTKGGKK |
Ga0193973_10278102 | 3300019737 | Sediment | MSTDLKQVNKSKRNSQRNDNSKELKLVERLIKIGR |
Ga0193983_10646951 | 3300019749 | Sediment | MSTDLKQVNKLKKTPRRNEISNEPKFVERLIKISRVSKVTKGGKKLSF |
Ga0194110_107642382 | 3300020084 | Freshwater Lake | MSTELKQINKLKKTARRNDNVNDNKFIERLIKISRVT |
Ga0211735_1042982019 | 3300020162 | Freshwater | MSSDLKQVNKLKKNTRRNNTIQEPKLVERLIKISRVSKVTKGGKKTKF |
Ga0206687_10866932 | 3300021169 | Seawater | MSSTLKKANKFKKNSRRVANLQEPKLVERLIKISRVSKVTKGGKK |
Ga0206687_11919563 | 3300021169 | Seawater | MSTDLKQINKVKKNPRSNNSNNEPKFVERLIKISRVSKVTKGGKKLSF |
Ga0206687_18979781 | 3300021169 | Seawater | MSTDLKQVNKLKKNSRRNDNRNEPKFVERLIKISRVSKVTKGG |
Ga0210348_1502866 | 3300021266 | Estuarine | MSSDLKKLNRLKKNSRRVQEPKLVERLIKISRVSKVTKG |
Ga0210353_1254272 | 3300021267 | Estuarine | MSSDLKQLNKGKKNSRRSTNLQEPKFVERLIKISRVSKVTKGGKN |
Ga0210340_10502163 | 3300021273 | Estuarine | MSSDLKKINKKNSRPTLNSQEPKFVERLIKISRVSKVTKGGKN |
Ga0210342_1477952 | 3300021275 | Estuarine | MSSDLKKLNKLKKNSRRVQEPKLVERLIKISRVSKVTKG |
Ga0210332_1316061 | 3300021278 | Estuarine | MTSDLKKINKKPNFRRKQNIQEPKLVERLIKISRV |
Ga0210303_10337783 | 3300021282 | Estuarine | MSSDLKQLNKLKKNSRRNNQPQEPKFVERLIKISRVSKVTKGGKKIKFPCDCCTW |
Ga0210303_10634273 | 3300021282 | Estuarine | MSTELKQINKLKKTARRNDNVNDNKFIERLIKISRVTKVTKGGKK |
Ga0210358_1784541 | 3300021293 | Estuarine | MSTDLKQINKAKKNLRRTDTVNEPKFVERLIKISRVSKVTKG |
Ga0210349_11437553 | 3300021298 | Estuarine | MSSDLKKINKKKNFRRNLNAQEPKLVERLIKISRVSKVTKGGKKIEF |
Ga0210296_107665011 | 3300021305 | Estuarine | MSTELKQVNKLKKTSRRNENLNDKFIERLIKISRVTKVTKGGKKIKFSCGSCYR |
Ga0210309_10505187 | 3300021317 | Estuarine | MSTELKQVNKLKKTSRRNTNLNDAKFIERLIKISRVTKVTKGGKN |
Ga0210362_13532213 | 3300021329 | Estuarine | MTSDLKQLNKVKKNSRRGNNLQEPKFIERLIKISRVSKVTKGG |
Ga0213858_102006991 | 3300021356 | Seawater | MSTDLKQVNKFKKNSRRFDNGNEPKFVERLIKISRVTKVTK |
Ga0213859_100401782 | 3300021364 | Seawater | MSTDLKQVNKKNTRRNDNDTKFVERLIKISRVSKVTKGGK |
Ga0213864_100397451 | 3300021379 | Seawater | MSTDLKQVNKSKKTSQRNDNSTESKFVERLIKISRVSKVTKGG |
Ga0213857_10137193 | 3300022171 | Watersheds | MSSDLKKVNKLKKNSRRNNNVQEPKFVERLIKISRVSKVTKGGKKIKFSSDCSNW |
Ga0224513_103267132 | 3300022220 | Sediment | MSTELKQVNKLKKTSRRNENLNDKFIERLIKISRVTKVTKGGKKLS |
Ga0210344_1005971 | 3300022366 | Estuarine | MSSDLKKINKKSSRRMANVQEPKFVERLIKISRVSKVTKGG |
Ga0210293_1144231 | 3300022372 | Estuarine | MSTDLKQLNKGRKNGRRNDASQEPKLVERLIKISRVSKVTKGGKK |
Ga0210318_11580201 | 3300022389 | Estuarine | MTSDLKKINKKPNSRRKQNIQEPKLVERLIKISRVSKVTK |
Ga0210003_12461273 | 3300024262 | Deep Subsurface | MSTDLKQVNKLKKNSRRPDNREPKLVERLIKISRV |
Ga0244775_115560311 | 3300024346 | Estuarine | MSTELKQVNKLKKTPRRNENLNDTKFIERLIKISRVTKVTKGGKKLSFR |
Ga0244776_109638262 | 3300024348 | Estuarine | MSTDLKQVNKFKKNSRRNDNRNEQKFVERLIKISRVSIVTKGG |
Ga0256352_10075085 | 3300024532 | Freshwater | MINTDIKQVNKLKKIPRTNENLNELRLVERLIKISRVSKVTKGGKKL |
Ga0256357_10626081 | 3300024534 | Freshwater | MINTDIKQVNKLKKIPRTNENLNELRLVERLIKISRVSKVTKGGKKLSF |
Ga0210011_10459931 | 3300025035 | Aquifer | MTSDLKKINKKSNSRRKQNIQESKLVERLIKISRVSKVTKGG |
Ga0209194_11163173 | 3300025632 | Pelagic Marine | MSTELKQVNKLKKTSRRNDNLNDAKFIERLIKISRV |
Ga0208150_11972991 | 3300025751 | Aqueous | MSTDLTQVNKLKKNPRRNERNNEPKFVERLIKIGRVSKVT |
Ga0209307_10389183 | 3300025832 | Pelagic Marine | MSTDLKQVNKSKKNSKRGDNSNEPKLVERLIKIGRVSKVTKGEKVKFPCYCCCRR |
Ga0209555_101877121 | 3300025879 | Marine | MSTDLKQVNKLKKNSRRTDQKNDQKFVERLIKISRVSKVTKGG |
Ga0208916_102750171 | 3300025896 | Aqueous | MTSDLKKINKLKPNSRRKQNTQEPKLVERLIKISRVSKVTKGG |
Ga0210013_10546463 | 3300025997 | Aquifer | MSTDLKRVNKKNSRRSGTAQEPKFVERLIKISRVSKVTKGGKKL |
Ga0209928_10367763 | 3300026131 | Soil | MSTELKQVNKLKKTSRRNENVNDATFIERLIKISRVTKVTK |
Ga0209951_11024881 | 3300026138 | Pond Water | MSTELKQVNKVKRTSRRNENLSDAKFIERLIKISRVTKVTKGGKKLSFR |
Ga0208797_10431182 | 3300027186 | Estuarine | MSTELKQVNKLKKTSRRNTNLNDAKFIERLIKISRVTK |
Ga0208676_10133131 | 3300027195 | Estuarine | MSTELKQVNKLKKTSRRNDNLNDNKFIERLIKISRVTKVTKGGKK |
Ga0208924_1081801 | 3300027204 | Estuarine | MSTELKQVNKLKKTSRRNDNLNDNKFIERLIKISR |
Ga0208554_10509413 | 3300027212 | Estuarine | MSTELKQVNKLKKTPRRNDNRNDDKFIERLIKIGRV |
Ga0208171_10157062 | 3300027230 | Estuarine | MSTDLKKQGRVKRNARRQPQFVERLIKISRVSKVTKG |
Ga0208174_10029765 | 3300027243 | Estuarine | MSTSLKQVNKPKKNVRRNDNRNEPKFAERLIKISRVSKVTKGGKKLSF |
Ga0208174_10331601 | 3300027243 | Estuarine | MSTDLKQLNKGRKNGRRNDASQEPKLVERLIKISRVSKVTKGGKKLS |
Ga0208923_10920602 | 3300027320 | Estuarine | MSTELKQINKLKKTARRNDNVNDNKFIERLIKISRVTKVTKGGKKL |
Ga0209968_10970121 | 3300027526 | Arabidopsis Thaliana Rhizosphere | MNSDLKKINKVKKNSRSNANFNKPRFVERLIKINRVSKV |
Ga0208947_11200591 | 3300027553 | Marine | MSTDLKQVNKLKKNSRRFDKENDPKFVERLIKISRVSKV |
Ga0209278_12472542 | 3300027673 | Wastewater Effluent | MTSDLKRINKKPNSRRKQNTQEPKLVERLIKISRVSK |
Ga0209090_103350803 | 3300027813 | Marine | MDTDLKRINKGKKNTRRNEVRFTERLIKISRVSKVTKGGK |
(restricted) Ga0255041_104092551 | 3300027837 | Seawater | MSTDLKQVNKKKTSRRPDNRNDQKFVERLIKIGRVSKVT |
Ga0209712_102059263 | 3300027849 | Marine | MSNDLKKINKKRNSRRNNNLQEPKFVERLIKISRVSKVTKGG |
Ga0209712_108204941 | 3300027849 | Marine | MSSDLKKINRKNSRRTSNTQEPKLVERLIKISRVSKVT |
Ga0209404_100611145 | 3300027906 | Marine | MNTDLKQVNKLKKNPRRNERNNEPRFVERLIKIGRV |
Ga0302271_102022143 | 3300029998 | Bog | MSNDLKKINKLKKNSRRPNNLTEPKFVERLIKISRVSKVTKGGKKL |
Ga0311349_119892222 | 3300030294 | Fen | MSNDLKKINKLKKNSRRPNNLTEPKFVERLIKISRVSKVTKGGKKLS |
Ga0307981_11103703 | 3300031223 | Saline Water | MTSELKNVNKSKKNFRRSNLAQEPKLMERLIKISRVSKV |
Ga0310813_104836801 | 3300031716 | Soil | MSSDLKKINKKKNSRRNLSVQEPKLVERLIKISRVSKVTKG |
Ga0316187_111225062 | 3300032231 | Worm Burrow | MSSDLKQLNKGKKNSRRSKNLQEPKFVERLIKISRVSKVTKGGKK |
Ga0316195_102075411 | 3300032263 | Sediment | MNTDLKKINKSKKNSRTNRNVPQTKFVERLIKISRVS |
Ga0316189_102097735 | 3300032272 | Worm Burrow | MSSDLKQLNKVKKNSRRGNNLQEPKFVERLIKISRVSKVTKGGKKLSFR |
Ga0316189_107826612 | 3300032272 | Worm Burrow | MTSDLKKINKQKPNSRRKQNFQEPRLVERLIKISRVSKVTKGGKKLS |
Ga0316204_106779641 | 3300032373 | Microbial Mat | MSNDLKKINKKNSRRINNSQEPKFVERLIKISRVSKVTKGGKKL |
Ga0316592_10111964 | 3300033524 | Rhizosphere | MSSDLKKINKKKNSRRNLNNQEPKLVERLIKISRVSKVTKGGKKN |
⦗Top⦘ |