Scaffold BICA1a_1198407

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold BICA1a_1198407

Scaffold BICA1a_1198407

Overview

Basic Information
Taxon OID	3300002735 Open in IMG/M
Scaffold ID	BICA1a_1198407 Open in IMG/M
Source Dataset Name	Deep subsurface microbial communities from Mt. Terri Underground Rock Laboratory, Switzerland - BIC-A1 borehole
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	549
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Clay → Unclassified → Deep Subsurface → Deep Subsurface Microbial Communities From Mt. Terri Underground Rock Laboratory, Switzerland, That Are Sulfate-Reducing

Source Dataset Sampling Location
Location Name	Mt. Terri, Switzerland
Coordinates	Lat. (^o)	47.379	Long. (^o)	7.1648	Alt. (m)		Depth (m)	300
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090615	Metagenome / Metatranscriptome	108	N

Sequences

Protein ID	Family	RBS	Sequence
BICA1a_11984071	F090615	N/A	ALRVRKGWLRPDSPIVDKAAAEGLKKLGVLLCPPPDADKRSATVKQINEVATEYLKAVPQARLLIEESVVEHQASWDPDKVYVERTDADIHEEMVTAIKTANADRLRAARAKASAGS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.