| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300002735 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0110172 | Gp0095176 | Ga0046459 |
| Sample Name | Deep subsurface microbial communities from Mt. Terri Underground Rock Laboratory, Switzerland - BIC-A1 borehole |
| Sequencing Status | Permanent Draft |
| Sequencing Center | |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 101737461 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Deep Subsurface Microbial Communities From Mt. Terri Underground Rock Laboratory, Switzerland, That Are Sulfate-Reducing |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Deep Subsurface → Clay → Unclassified → Deep Subsurface → Deep Subsurface Microbial Communities From Mt. Terri Underground Rock Laboratory, Switzerland, That Are Sulfate-Reducing |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | terrestrial biome → planetary subsurface zone → clay soil |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Mt. Terri, Switzerland | |||||||
| Coordinates | Lat. (o) | 47.379 | Long. (o) | 7.1648 | Alt. (m) | N/A | Depth (m) | 300 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F090615 | Metagenome / Metatranscriptome | 108 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| BICA1a_1040437 | Not Available | 541 | Open in IMG/M |
| BICA1a_1198407 | Not Available | 549 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| BICA1a_1040437 | BICA1a_10404371 | F090615 | ALRVRKGWLRPDSPIVDKAAAEGLKKLGVLLCPPPDADKRSATVKQINEVATEYLKAVPQARLLIEESVVEHQASWDPDKVYVERTDADIHEEMVTAIKTANADRLRAAEAKAAAGS* |
| BICA1a_1198407 | BICA1a_11984071 | F090615 | ALRVRKGWLRPDSPIVDKAAAEGLKKLGVLLCPPPDADKRSATVKQINEVATEYLKAVPQARLLIEESVVEHQASWDPDKVYVERTDADIHEEMVTAIKTANADRLRAARAKASAGS* |
| ⦗Top⦘ |