Basic Information | |
---|---|
IMG/M Taxon OID | 3300002735 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0110172 | Gp0095176 | Ga0046459 |
Sample Name | Deep subsurface microbial communities from Mt. Terri Underground Rock Laboratory, Switzerland - BIC-A1 borehole |
Sequencing Status | Permanent Draft |
Sequencing Center | |
Published? | Y |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 101737461 |
Sequencing Scaffolds | 2 |
Novel Protein Genes | 2 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 2 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Deep Subsurface Microbial Communities From Mt. Terri Underground Rock Laboratory, Switzerland, That Are Sulfate-Reducing |
Type | Environmental |
Taxonomy | Environmental → Terrestrial → Deep Subsurface → Clay → Unclassified → Deep Subsurface → Deep Subsurface Microbial Communities From Mt. Terri Underground Rock Laboratory, Switzerland, That Are Sulfate-Reducing |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | terrestrial biome → planetary subsurface zone → clay soil |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Mt. Terri, Switzerland | |||||||
Coordinates | Lat. (o) | 47.379 | Long. (o) | 7.1648 | Alt. (m) | N/A | Depth (m) | 300 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F090615 | Metagenome / Metatranscriptome | 108 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
BICA1a_1040437 | Not Available | 541 | Open in IMG/M |
BICA1a_1198407 | Not Available | 549 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
BICA1a_1040437 | BICA1a_10404371 | F090615 | ALRVRKGWLRPDSPIVDKAAAEGLKKLGVLLCPPPDADKRSATVKQINEVATEYLKAVPQARLLIEESVVEHQASWDPDKVYVERTDADIHEEMVTAIKTANADRLRAAEAKAAAGS* |
BICA1a_1198407 | BICA1a_11984071 | F090615 | ALRVRKGWLRPDSPIVDKAAAEGLKKLGVLLCPPPDADKRSATVKQINEVATEYLKAVPQARLLIEESVVEHQASWDPDKVYVERTDADIHEEMVTAIKTANADRLRAARAKASAGS* |
⦗Top⦘ |