NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300002735

3300002735: Deep subsurface microbial communities from Mt. Terri Underground Rock Laboratory, Switzerland - BIC-A1 borehole



Overview

Basic Information
IMG/M Taxon OID3300002735 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0110172 | Gp0095176 | Ga0046459
Sample NameDeep subsurface microbial communities from Mt. Terri Underground Rock Laboratory, Switzerland - BIC-A1 borehole
Sequencing StatusPermanent Draft
Sequencing Center
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size101737461
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDeep Subsurface Microbial Communities From Mt. Terri Underground Rock Laboratory, Switzerland, That Are Sulfate-Reducing
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Deep Subsurface → Clay → Unclassified → Deep Subsurface → Deep Subsurface Microbial Communities From Mt. Terri Underground Rock Laboratory, Switzerland, That Are Sulfate-Reducing

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeplanetary subsurface zoneclay soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationMt. Terri, Switzerland
CoordinatesLat. (o)47.379Long. (o)7.1648Alt. (m)N/ADepth (m)300
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F090615Metagenome / Metatranscriptome108N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
BICA1a_1040437Not Available541Open in IMG/M
BICA1a_1198407Not Available549Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
BICA1a_1040437BICA1a_10404371F090615ALRVRKGWLRPDSPIVDKAAAEGLKKLGVLLCPPPDADKRSATVKQINEVATEYLKAVPQARLLIEESVVEHQASWDPDKVYVERTDADIHEEMVTAIKTANADRLRAAEAKAAAGS*
BICA1a_1198407BICA1a_11984071F090615ALRVRKGWLRPDSPIVDKAAAEGLKKLGVLLCPPPDADKRSATVKQINEVATEYLKAVPQARLLIEESVVEHQASWDPDKVYVERTDADIHEEMVTAIKTANADRLRAARAKASAGS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.