Basic Information | |
---|---|
Taxon OID | 3300002733 Open in IMG/M |
Scaffold ID | codie8draft_1046829 Open in IMG/M |
Source Dataset Name | Coal-bed methane well microbial communities from Surat Basin, Queensland, Australia, Sample - Codie-8 produced water |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 4062 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Coal-Bed Methane Well → Coal-Bed Methane Well Microbial Communities From Surat Basin, Queensland, Australia |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Australia: Tara, Queensland | |||||||
Coordinates | Lat. (o) | -27.0061 | Long. (o) | 150.3916 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F065714 | Metagenome / Metatranscriptome | 127 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
codie8draft_10468292 | F065714 | AGGA | MKLFRRLLLVLSVATAVVGILRFGGSEKSRVTTKQGGWRNYSSPE* |
⦗Top⦘ |