| Basic Information | |
|---|---|
| Taxon OID | 3300002733 Open in IMG/M |
| Scaffold ID | codie8draft_1032042 Open in IMG/M |
| Source Dataset Name | Coal-bed methane well microbial communities from Surat Basin, Queensland, Australia, Sample - Codie-8 produced water |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1239 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (83.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Coal-Bed Methane Well → Coal-Bed Methane Well Microbial Communities From Surat Basin, Queensland, Australia |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Australia: Tara, Queensland | |||||||
| Coordinates | Lat. (o) | -27.0061 | Long. (o) | 150.3916 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F073483 | Metagenome / Metatranscriptome | 120 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| codie8draft_10320424 | F073483 | AGGA | MTIETKDLRLLKTDYGHRIKAVEARVVRLEKRIDWVEKLLWLSAGAIISWLVTWVIRSV* |
| ⦗Top⦘ |