Scaffold codie8draft_1024371

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold codie8draft_1024371

Scaffold codie8draft_1024371

Overview

Basic Information
Taxon OID	3300002733 Open in IMG/M
Scaffold ID	codie8draft_1024371 Open in IMG/M
Source Dataset Name	Coal-bed methane well microbial communities from Surat Basin, Queensland, Australia, Sample - Codie-8 produced water
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	540
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Coal-Bed Methane Well → Coal-Bed Methane Well Microbial Communities From Surat Basin, Queensland, Australia

Source Dataset Sampling Location
Location Name	Australia: Tara, Queensland
Coordinates	Lat. (^o)	-27.0061	Long. (^o)	150.3916	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002370	Metagenome / Metatranscriptome	566	Y

Sequences

Protein ID	Family	RBS	Sequence
codie8draft_10243711	F002370	AGGAG	MKDMAKKAVHKHERSMHPGKPLTKMAKGGKTNLDMKKMGRNLAKVANQNRPMRSVPKSGI

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.