Basic Information | |
---|---|
Taxon OID | 3300002684 Open in IMG/M |
Scaffold ID | Ga0005277J37296_1017543 Open in IMG/M |
Source Dataset Name | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI075_200m_B (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2206 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | British Columbia, Canada | |||||||
Coordinates | Lat. (o) | 48.7299 | Long. (o) | -123.5699 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F039110 | Metagenome / Metatranscriptome | 164 | Y |
F046847 | Metagenome / Metatranscriptome | 150 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0005277J37296_10175431 | F046847 | N/A | VNVMPDVDKTETVNTPKTENEVVISQSKLDALIDKGFSKGAKRAKSELTEQLGVDSFEQARELILAKKEADDANKSELEKAAELISTLNSTIEGLETNNQKIQADMAIQKVVSDNGIKDADYFKHLLAQASRSEDFNQDEFITDLKGVKPYLFKGADNQPKKVDATSNRASLDVNDRIKSTKTMAELRALQNEI* |
Ga0005277J37296_10175433 | F039110 | GGAG | MGKVTKTAVAKKVTKPQLKAICDGSHCIDGGIYTFKTGDVITLSKKSHYESMKGLSCFNEV* |
⦗Top⦘ |