Scaffold Ga0005490J37275_101953

Overview

Basic Information

• Taxon OID: 3300002672
• Scaffold ID: Ga0005490J37275_101953
• Source Dataset Name: Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF139 (Metagenome Metatranscriptome, Counting Only)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1816
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Harvard Forest Long Term Ecological Research (Lter) Site In Petersham, Ma, For Long-Term Soil Warming Studies

Source Dataset Sampling Location

• Location Name: Harvard Forest LTER, Petersham, MA, USA
• Coordinates
  • Lat. (^o): 42.53312
  • Long. (^o): -72.189707
  • Depth (m): 0 to .1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F098663	Metagenome / Metatranscriptome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0005490J37275_1019533	F098663	N/A	MLLLQVLHGCRQSVL*EVRLTPLTDEIPVVNLYLTINGADRVSFGAKTSRYGPYELGYRRATKIFTK*CKTVPLNLIWLFA*