NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold DRAFT_10675878

Scaffold DRAFT_10675878


Overview

Basic Information
Taxon OID3300002597 Open in IMG/M
Scaffold IDDRAFT_10675878 Open in IMG/M
Source Dataset NameCamel rumen microbial communities from Jandagh-Isfahan, Iran - Sample 1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBeijing Genomics Institute (BGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1267
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Camel Rumen → Camel Rumen Microbial Communities From Jandagh-Isfahan, Iran

Source Dataset Sampling Location
Location NameJandaq, Isfahan Province, Iran
CoordinatesLat. (o)34.041281Long. (o)54.414582Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F059440Metagenome / Metatranscriptome134Y

Sequences

Protein IDFamilyRBSSequence
DRAFT_106758782F059440N/AMEQKSRKEREAEFKAKIAKLDAYVEEMNAKGNLTDEEWKEVWSAMLQTNKYLRAIGAPESEMYDI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.