NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold draft_1399096

Scaffold draft_1399096


Overview

Basic Information
Taxon OID3300002596 Open in IMG/M
Scaffold IDdraft_1399096 Open in IMG/M
Source Dataset NameHydrocarbon contaminated oil fields microbial communities from Alberta, Canada - Microbes in water sample from Medicine Hat oil field -PW_MHGC_2012April10
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMcGill University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1578
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location
Location NameMedicine Hat, Alberta Canada
CoordinatesLat. (o)50.033333Long. (o)-110.666667Alt. (m)Depth (m)800
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003987Metagenome / Metatranscriptome458Y

Sequences

Protein IDFamilyRBSSequence
draft_13990962F003987AGCAGGMIPALPCGTFSDGDTPAGAFYVAAFEDSDQPHHVTECRIETVLRALRAIQACGYDDVEIGSIERGGKTHLLLIGLDGEARFGDRQLGCIAVLPVEVE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.