| Basic Information | |
|---|---|
| Taxon OID | 3300002596 Open in IMG/M |
| Scaffold ID | draft_1361043 Open in IMG/M |
| Source Dataset Name | Hydrocarbon contaminated oil fields microbial communities from Alberta, Canada - Microbes in water sample from Medicine Hat oil field -PW_MHGC_2012April10 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | McGill University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 745 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Medicine Hat, Alberta Canada | |||||||
| Coordinates | Lat. (o) | 50.033333 | Long. (o) | -110.666667 | Alt. (m) | Depth (m) | 800 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F053364 | Metagenome / Metatranscriptome | 141 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| draft_13610431 | F053364 | AGGGGG | MSDPLNDILVECCKLRGCYPLMHRTLHEFDWFCSCVIWGAGRDIDNEIVQAEADGDEALSGLLRDLRAEKNMIRDRFGGQTPYGPDELIRFAEAFRIYCREQYGDEEVGA* |
| ⦗Top⦘ |