Basic Information | |
---|---|
Taxon OID | 3300002596 Open in IMG/M |
Scaffold ID | draft_1330936 Open in IMG/M |
Source Dataset Name | Hydrocarbon contaminated oil fields microbial communities from Alberta, Canada - Microbes in water sample from Medicine Hat oil field -PW_MHGC_2012April10 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | McGill University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 552 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Medicine Hat, Alberta Canada | |||||||
Coordinates | Lat. (o) | 50.033333 | Long. (o) | -110.666667 | Alt. (m) | Depth (m) | 800 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F005744 | Metagenome / Metatranscriptome | 391 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
draft_13309362 | F005744 | N/A | APDAPPEQALYRIQQTYPDGSGGRLNIDWTGLHRLHDLIHDWIAMEGCVCETCSTRGCHRPATWEIECRGAGVSGRLIYSCDEHCPDPAILSPQDEIRRLVEV* |
⦗Top⦘ |